Recombinant Mouse FZD7 Protein (33-254 aa), His-Avi-tagged

Cat.No. : FZD7-3410M
Product Overview : Recombinant Mouse Frizzled-7 (FZD7), His-Avi-tagged, expressed in HEK293 cells
Availability September 29, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : Avi&His
Protein Length : 33-254 aa
Description : Frizzled-7 (FZD7) is a member of the Frizzled family of 7-transmembrane receptors that serve as receptors for Wnt signaling proteins. FZD7 contains an N-terminal signal sequence, a cysteine-rich domain (CRD) with 10 conserved cysteines, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif. It plays key roles in Wnt/beta-catenin signaling, cell polarity, stem cell self-renewal, skeletal muscle regeneration, and cancer biology.
Form : Liquid
Molecular Mass : 28 kDa (222 aa including His-Avi-tag), confirmed by calculated MW
AASequence : HHHHHHHHGLNDIFEAQKIEWHEQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGAGGSPTAYPTAPYLPDPPFTAMSPSDGRGRLSFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLW
Endotoxin : <1 EU/µg (LAL method)
Purity : >90% (by SDS-PAGE)
Storage : Store under sterile conditions at -20°C to -80°C; aliquot to avoid repeated freeze-thaw cycles
Concentration : 0.07 mg/ml (BCA assay)
Storage Buffer : Sterile PBS, pH 7.4
Gene Name Fzd7
Official Symbol FZD7
Synonyms Fz7;mFz7
Gene ID 14369
mRNA Refseq NM_008057.3
Protein Refseq NP_032083.3
MIM 603410
UniProt ID Q61090

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FZD7 Products

Required fields are marked with *

My Review for All FZD7 Products

Required fields are marked with *

0
cart-icon
0
compare icon