Recombinant Mouse FZD7 Protein (33-254 aa), His-Avi-tagged

• Cat.No.: FZD7-3410M
• Product Overview: Recombinant Mouse Frizzled-7 (FZD7), His-Avi-tagged, expressed in HEK293 cells

Specification

• Species: Mouse
• Source: HEK293
• Tag: Avi&His
• Protein Length: 33-254 aa
• Description: Frizzled-7 (FZD7) is a member of the Frizzled family of 7-transmembrane receptors that serve as receptors for Wnt signaling proteins. FZD7 contains an N-terminal signal sequence, a cysteine-rich domain (CRD) with 10 conserved cysteines, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif. It plays key roles in Wnt/beta-catenin signaling, cell polarity, stem cell self-renewal, skeletal muscle regeneration, and cancer biology.
• Form: Liquid
• Molecular Mass: 28 kDa (222 aa including His-Avi-tag), confirmed by calculated MW
• AASequence: HHHHHHHHGLNDIFEAQKIEWHEQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGAGGSPTAYPTAPYLPDPPFTAMSPSDGRGRLSFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLW
• Endotoxin: <1 EU/µg (LAL method)
• Purity: >90% (by SDS-PAGE)
• Storage: Store under sterile conditions at -20°C to -80°C; aliquot to avoid repeated freeze-thaw cycles
• Concentration: 0.07 mg/ml (BCA assay)
• Storage Buffer: Sterile PBS, pH 7.4

Gene Information

• Gene Name: Fzd7
• Official Symbol: FZD7
• Synonyms: Fz7;mFz7
• Gene ID: 14369
• mRNA Refseq: NM_008057.3
• Protein Refseq: NP_032083.3
• MIM: 603410
• UniProt ID: Q61090