Recombinant Mouse FZD7 Protein (33-254 aa), His-Avi-tagged
| Cat.No. : | FZD7-3410M |
| Product Overview : | Recombinant Mouse Frizzled-7 (FZD7), His-Avi-tagged, expressed in HEK293 cells |
| Availability | July 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | Avi&His |
| Protein Length : | 33-254 aa |
| Description : | Frizzled-7 (FZD7) is a member of the Frizzled family of 7-transmembrane receptors that serve as receptors for Wnt signaling proteins. FZD7 contains an N-terminal signal sequence, a cysteine-rich domain (CRD) with 10 conserved cysteines, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif. It plays key roles in Wnt/beta-catenin signaling, cell polarity, stem cell self-renewal, skeletal muscle regeneration, and cancer biology. |
| Form : | Liquid |
| Molecular Mass : | 28 kDa (222 aa including His-Avi-tag), confirmed by calculated MW |
| AASequence : | HHHHHHHHGLNDIFEAQKIEWHEQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGAGGSPTAYPTAPYLPDPPFTAMSPSDGRGRLSFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLW |
| Endotoxin : | <1 EU/µg (LAL method) |
| Purity : | >90% (by SDS-PAGE) |
| Storage : | Store under sterile conditions at -20°C to -80°C; aliquot to avoid repeated freeze-thaw cycles |
| Concentration : | 0.07 mg/ml (BCA assay) |
| Storage Buffer : | Sterile PBS, pH 7.4 |
| Gene Name | Fzd7 |
| Official Symbol | FZD7 |
| Synonyms | Fz7;mFz7 |
| Gene ID | 14369 |
| mRNA Refseq | NM_008057.3 |
| Protein Refseq | NP_032083.3 |
| MIM | 603410 |
| UniProt ID | Q61090 |
| ◆ Recombinant Proteins | ||
| RFL33853XF | Recombinant Full Length Xenopus Tropicalis Frizzled-7(Fzd7) Protein, His-Tagged | +Inquiry |
| FZD7-12H | Recombinant Human FZD7 protein, Fc-tagged | +Inquiry |
| RFL20929MF | Recombinant Full Length Mouse Frizzled-7(Fzd7) Protein, His-Tagged | +Inquiry |
| FZD7-643H | Active Recombinant Human FZD7 protein, His-tagged | +Inquiry |
| FZD7-2704H | Active Recombinant Human FZD7 protein, hFc&His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FZD7-6088HCL | Recombinant Human FZD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FZD7 Products
Required fields are marked with *
My Review for All FZD7 Products
Required fields are marked with *



