Recombinant Mouse Ifng protein, His-tagged
Cat.No. : | Ifng-3076M |
Product Overview : | Recombinant Mouse Ifng protein(P01580)(27-155aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 27-155aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.1 kDa |
AA Sequence : | IESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Ifng interferon gamma [ Mus musculus ] |
Official Symbol | Ifng |
Synonyms | IFNG; interferon gamma; IFN-gamma; gamma interferon; Ifg; IFN-g; |
Gene ID | 15978 |
mRNA Refseq | NM_008337 |
Protein Refseq | NP_032363 |
◆ Recombinant Proteins | ||
IFNG-8860H | Active Recombinant Human IFNG, His-tagged | +Inquiry |
IFNG-7822C | Recombinant Canine IFNG protein | +Inquiry |
Ifng-019H | Recombinant Hamster Ifng Protein, Met1-Ile174, C-His tagged | +Inquiry |
IFNG-21P | Recombinant Porcine Interferon-gamma | +Inquiry |
Ifng-119M | Recombinant Mouse Ifng protein(Met1-Cys155), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ifng Products
Required fields are marked with *
My Review for All Ifng Products
Required fields are marked with *