Recombinant Mouse Il18 protein, His-tagged
Cat.No. : | Il18-3094M |
Product Overview : | Recombinant Mouse Il18 protein(P70380)(1-192aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-192aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.1 kDa |
AA Sequence : | MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Il18 interleukin 18 [ Mus musculus ] |
Official Symbol | Il18 |
Synonyms | IL18; interleukin 18; interleukin-18; IL-1 gamma; interleukin-1 gamma; IFN-gamma-inducing factor; interferon gamma-inducing factor; interferon-gamma-inducing factor; Igif; Il-18; |
Gene ID | 16173 |
mRNA Refseq | NM_008360 |
Protein Refseq | NP_032386 |
◆ Recombinant Proteins | ||
IL18-336H | Active Recombinant Human IL18 protein | +Inquiry |
IL18-2366M | Recombinant Mouse IL18 protein(Asn36-Ser192) | +Inquiry |
IL18-83M | Recombinant Mouse IL-18 | +Inquiry |
IL18-876P | Recombinant Pig IL18 protein, His & T7-tagged | +Inquiry |
IL18-2057R | Recombinant Rhesus Macaque IL18 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IL18-01D | Recombinant Dog IL18 Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL18-344HCL | Recombinant Human IL18 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All Il18 Products
Required fields are marked with *
My Review for All Il18 Products
Required fields are marked with *