Recombinant Mouse Il18 protein, His-tagged
Cat.No. : | Il18-6543M |
Product Overview : | Recombinant Mouse Il18 protein(P70380)(36-192aa(N36H,M85A,K87G,E90R,V91A,L94K)), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 36-192a.a.(N36H,M85A,K87G,E90R,V91A,L94K) |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | HFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYAYGDSRARGKAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS |
Gene Name | Il18 interleukin 18 [ Mus musculus ] |
Official Symbol | Il18 |
Synonyms | IL18; interleukin 18; interleukin-18; IL-1 gamma; interleukin-1 gamma; IFN-gamma-inducing factor; interferon gamma-inducing factor; interferon-gamma-inducing factor; Igif; Il-18; |
Gene ID | 16173 |
mRNA Refseq | NM_008360 |
Protein Refseq | NP_032386 |
◆ Recombinant Proteins | ||
Il18-368I | Active Recombinant Rat Il18 Protein (159 aa) | +Inquiry |
Il18-6740M | Recombinant Mouse Il18 Protein (Asn36-Ser192), C-His tagged | +Inquiry |
IL18-1237H | Active Recombinant Human IL18 | +Inquiry |
Il18-01M | Active Recombinant Mouse Il18 Protein, His-Tagged | +Inquiry |
Il18-877R | Recombinant Rat Il18 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL18-344HCL | Recombinant Human IL18 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (1)
Ask a questionIL18-01HG: Sequence: a.a.37-193 Endotoxin: <20 EU/mg Bio-activity: >5.0 x 10^4 IU/mg QC: Activity test, SDS-PAGE, LAL, SEC-HPLC IL18-153HG: Protein length: Tyr37-Asp193 AA Sequence: YFGKLESKLS VIRNLNDQVL FIDQGNRPLF EDMTDSDCRD NAPRTIFIISMYKDSQPRGM AVTISVKCEK ISTLSCENKI ISFKEMNPPD NIKDTKSDIIFFQRSVPGHD NKMQFESSSY EGYFLACEKE RDLFKLILKK EDELGDRSIMFTVQNEDVD Bio-activity: 1.0*10^6IU Measured by its ability to induce IFN-gamma secretion by KG‐1 human acute myelogenous leukemia cells in the presence of TNF-alpha. QC: Activity test, SDS-PAGE, LAL IL18-500H Recombinant Human IL18 will be custom produced upon order. All the sequence, purity, activity, and QC procedures will be optional and decided by our customer.
Ask a Question for All Il18 Products
Required fields are marked with *
My Review for All Il18 Products
Required fields are marked with *
Inquiry Basket