Recombinant Mouse Il18 protein, His-tagged
| Cat.No. : | Il18-6543M |
| Product Overview : | Recombinant Mouse Il18 protein(P70380)(36-192aa(N36H,M85A,K87G,E90R,V91A,L94K)), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 36-192a.a.(N36H,M85A,K87G,E90R,V91A,L94K) |
| Tag : | His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 24.0 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | HFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYAYGDSRARGKAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS |
| Gene Name | Il18 interleukin 18 [ Mus musculus ] |
| Official Symbol | Il18 |
| Synonyms | IL18; interleukin 18; interleukin-18; IL-1 gamma; interleukin-1 gamma; IFN-gamma-inducing factor; interferon gamma-inducing factor; interferon-gamma-inducing factor; Igif; Il-18; |
| Gene ID | 16173 |
| mRNA Refseq | NM_008360 |
| Protein Refseq | NP_032386 |
| ◆ Recombinant Proteins | ||
| IL18-574H | Recombinant Human IL18, GST tagged | +Inquiry |
| Il18-1241M | Recombinant Mouse Il18 Protein, MYC/DDK-tagged | +Inquiry |
| IL18-1237H | Active Recombinant Human IL18 | +Inquiry |
| IL18-94H | Recombinant Human IL18 Protein, His-tagged | +Inquiry |
| Il18-436R | Active Recombinant Rat Il18 | +Inquiry |
| ◆ Native Proteins | ||
| IL18-01D | Recombinant Dog IL18 Protein, Tag Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL18-344HCL | Recombinant Human IL18 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All Il18 Products
Required fields are marked with *
My Review for All Il18 Products
Required fields are marked with *