Recombinant Mouse Il1f9 protein

Cat.No. : Il1f9-648M
Product Overview : Recombinant Mouse Il1f9 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 152
Description : Interleukin-36 (IL-36) is a pro-inflammatory cytokine which plays an important role in the pathophysiology of several diseases. IL-36α, IL-36β, and IL-36γ (formerly IL-1F6, IL-1F8, and IL-1F9) are IL-1 family members that signal through the IL-1 receptor family members IL-1Rrp2 (IL-1RL2) and IL-1RAcP. IL-36γ is secreted when transfected into 293-T cells and it could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1). Furthermore, IL-36γ also can function as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2. Recombinant murine IL-36γ is synthesized as a 17.3 kDa, 152 amino acid (a.a.) protein that contains no signal sequence, no prosegment and no potential N-linked glycosylation site. Murine to human, IL-36γ shares 53 % a.a. identity. Within the family, IL-36γ shares about 25 % ~ 55 % a.a. sequence identity with IL-1RA, IL-1β, IL-36RA, IL-36α, IL-37, IL-36β and IL-1F10.
Form : Lyophilized from a 0.2μm filtered solution in 1 M MOPS, 10 mM NaAC, pH7.6, with 2 mM EDTA, 5 % Trehalose, 0.02 % Tween-20.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion in murine NIH/3T3 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg.
Molecular Mass : Approximately 17.3 kDa, a single non-glycosylated polypeptide chain containing 152 amino acids.
AA Sequence : GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS
Endotoxin : Less than 0.1 EU/μg of rMuIL-36γ, 152a.a. as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Il1f9
Official Symbol Il1f9
Synonyms IL1F9; interleukin 1 family, member 9; interleukin-36 gamma; IL-1F9; interleukin-1 family member 9; Il36g;
Gene ID 215257
mRNA Refseq NM_153511
Protein Refseq NP_705731
UniProt ID Q8R460

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL36G Products

Required fields are marked with *

My Review for All IL36G Products

Required fields are marked with *

0

Inquiry Basket

cartIcon