Recombinant Mouse IL28B protein
Cat.No. : | IL28B-65M |
Product Overview : | Recombinant Mouse IL28B protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 174 |
Description : | This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using human HepG2 cells infected with encephalomyocarditis is less than 30 ng/ml, corresponding to a specific activity of > 3.3 × 10⁴ IU/mg. |
Molecular Mass : | Approximately 19.6 kDa, a single non-glycosylated polypeptide chain containing 174 amino acids. |
AA Sequence : | DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKGAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENINDSALTTILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFQLLLRDLKCVASGDQCV |
Endotoxin : | Less than 1 EU/µg of rMuIFN-λ3/IL-28B as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL28B |
Official Symbol | IL28B |
Synonyms | IL28B; interleukin 28B; interleukin-28B; IFN-lambda-3; interleukin 28; interferon alpha; interferon lambda-3; Il28; IFL-1; IL-28B; INF-alpha; INF-lambda; |
Gene ID | 338374 |
mRNA Refseq | NM_177396 |
Protein Refseq | NP_796370 |
UniProt ID | Q8CGK6 |
◆ Recombinant Proteins | ||
IL28B-65M | Recombinant Mouse IL28B protein | +Inquiry |
IL28B-8163M | Recombinant Mouse IL28B Protein | +Inquiry |
Il28b-212M | Recombinant Mouse Interleukin 28B | +Inquiry |
Il28b-153M | Active Recombinant Mouse Il28b Protein (Asp20-Val193), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL28B-600H | Recombinant Human Interleukin 28B (interferon, lambda 3) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL28B Products
Required fields are marked with *
My Review for All IL28B Products
Required fields are marked with *
0
Inquiry Basket