Recombinant Mouse Il2rb protein, His-tagged

Cat.No. : Il2rb-3101M
Product Overview : Recombinant Mouse Il2rb protein(P16297)(24-240aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 24-240aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 29.3 kDa
AA Sequence : ASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Il2rb interleukin 2 receptor, beta chain [ Mus musculus ]
Official Symbol Il2rb
Synonyms IL2RB; interleukin 2 receptor, beta chain; interleukin-2 receptor subunit beta; IL-2RB; p70-75; IL-2R subunit beta; IL-2/15 receptor-beta; IL-2 receptor beta chain; IL-15 receptor beta chain; IL-2 receptor subunit beta; high affinity IL-2 receptor subunit beta; p70; CD122; IL15Rbeta; Il-2Rbeta; IL-15Rbeta; Il-2/15Rbeta; MGC118674;
Gene ID 16185
mRNA Refseq NM_008368
Protein Refseq NP_032394

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il2rb Products

Required fields are marked with *

My Review for All Il2rb Products

Required fields are marked with *

0
cart-icon
0
compare icon