Recombinant Mouse Il2rb protein, His-tagged
| Cat.No. : | Il2rb-3101M |
| Product Overview : | Recombinant Mouse Il2rb protein(P16297)(24-240aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 24-240aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 29.3 kDa |
| AA Sequence : | ASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Il2rb interleukin 2 receptor, beta chain [ Mus musculus ] |
| Official Symbol | Il2rb |
| Synonyms | IL2RB; interleukin 2 receptor, beta chain; interleukin-2 receptor subunit beta; IL-2RB; p70-75; IL-2R subunit beta; IL-2/15 receptor-beta; IL-2 receptor beta chain; IL-15 receptor beta chain; IL-2 receptor subunit beta; high affinity IL-2 receptor subunit beta; p70; CD122; IL15Rbeta; Il-2Rbeta; IL-15Rbeta; Il-2/15Rbeta; MGC118674; |
| Gene ID | 16185 |
| mRNA Refseq | NM_008368 |
| Protein Refseq | NP_032394 |
| ◆ Recombinant Proteins | ||
| IL2RB-619C | Recombinant Cynomolgus IL2RB protein, His-tagged, Biotinylated | +Inquiry |
| IL2RB-701H | Active Recombinant Human IL2RB, HIgG1 Fc-tagged | +Inquiry |
| IL2RB-201H | Recombinant Human IL2RB protein, His-Avi-tagged | +Inquiry |
| IL2RB-782H | Recombinant Human IL2RB protein, Fc-tagged | +Inquiry |
| IL2RB-2699R | Recombinant Rat IL2RB Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL2RB-741CCL | Recombinant Canine IL2RB cell lysate | +Inquiry |
| IL2RB-2906HCL | Recombinant Human IL2RB cell lysate | +Inquiry |
| IL2RB-744MCL | Recombinant Mouse IL2RB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il2rb Products
Required fields are marked with *
My Review for All Il2rb Products
Required fields are marked with *
