Recombinant Mouse Il2rb protein, His-tagged
Cat.No. : | Il2rb-3101M |
Product Overview : | Recombinant Mouse Il2rb protein(P16297)(24-240aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-240aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.3 kDa |
AA Sequence : | ASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Il2rb interleukin 2 receptor, beta chain [ Mus musculus ] |
Official Symbol | Il2rb |
Synonyms | IL2RB; interleukin 2 receptor, beta chain; interleukin-2 receptor subunit beta; IL-2RB; p70-75; IL-2R subunit beta; IL-2/15 receptor-beta; IL-2 receptor beta chain; IL-15 receptor beta chain; IL-2 receptor subunit beta; high affinity IL-2 receptor subunit beta; p70; CD122; IL15Rbeta; Il-2Rbeta; IL-15Rbeta; Il-2/15Rbeta; MGC118674; |
Gene ID | 16185 |
mRNA Refseq | NM_008368 |
Protein Refseq | NP_032394 |
◆ Recombinant Proteins | ||
IL2RB-1007R | Active Recombinant Rhesus IL2RB Protein (Met1-Asp239), His-tagged | +Inquiry |
IL2RB-1554R | Recombinant Rhesus Monkey IL2RB Protein, hIgG1-tagged | +Inquiry |
IL2RB-066H | Recombinant Human IL2RB Protein, C-His-tagged | +Inquiry |
IL2RB-1257M | Recombinant Mouse IL2RB Protein, His-tagged | +Inquiry |
IL2Rb-3328P | Recombinant Pig IL2Rb protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2RB-741CCL | Recombinant Canine IL2RB cell lysate | +Inquiry |
IL2RB-744MCL | Recombinant Mouse IL2RB cell lysate | +Inquiry |
IL2RB-2906HCL | Recombinant Human IL2RB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il2rb Products
Required fields are marked with *
My Review for All Il2rb Products
Required fields are marked with *
0
Inquiry Basket