Species : |
Mouse |
Source : |
E.coli |
Tag : |
His |
Protein Length : |
Gly47~Gln257 |
Form : |
20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300. |
Molecular Mass : |
29kDa as determined by SDS-PAGE reducing conditions. |
AA Sequence : |
GQKAGAFTCLSNSIYRIDCHWSAPELGQESRAWLLFTSNQVTEIKHKCTFWDSMCTLVLPKEEVFLPFDNFTITLHRCIMGQEQVSLVDSQYLPRRHIKLDPPSDLQSNVSSGRCVLTWGINLALEPLITSLSYELAFKRQEEAWEARHKDRIVGVTWLILEAVELNPGSIYEARLRVQMTLESYEDKTEGEYYKSHWSEWSQPVSFPSPQ |
Endotoxin : |
<1.0EU per 1µg (determined by the LAL method). |
Purity : |
>95% as determined by SDS-PAGE. |
Applications : |
Positive Control; Immunogen; SDS-PAGE; WB. If bio-activity of the protein is needed, please check active protein. |
Notes : |
The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures. |
Stability : |
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
Storage : |
Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months. |
Concentration : |
200µg/ml |
Reconstitution : |
Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |