Recombinant Rat INS1 Protein (25-54 aa), His-SUMO-tagged
Cat.No. : | INS1-2436R |
Product Overview : | Recombinant Rat INS1 Protein (25-54 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 25-54 aa |
Description : | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 19.4 kDa |
AA Sequence : | FVKQHLCGPHLVEALYLVCGERGFFYTPKS |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Ins1 insulin 1 [ Rattus norvegicus ] |
Official Symbol | INS1 |
Synonyms | INS1; insulin 1; insulin-1; |
Gene ID | 24505 |
mRNA Refseq | NM_019129 |
Protein Refseq | NP_062002 |
UniProt ID | P01322 |
◆ Recombinant Proteins | ||
INS1-63M | Recombinant Mouse INS1 Protein, His/Myc-tagged | +Inquiry |
INS1-2164M | Recombinant Mouse INS1 Protein (25-108 aa), His-Myc-tagged | +Inquiry |
RFL19133SF | Recombinant Full Length Schizosaccharomyces Pombe Insig Family Protein(Ins1) Protein, His-Tagged | +Inquiry |
INS1-8233M | Recombinant Mouse INS1 Protein | +Inquiry |
INS1-4560M | Recombinant Mouse INS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INS1 Products
Required fields are marked with *
My Review for All INS1 Products
Required fields are marked with *