Recombinant Rat INS1 Protein (25-54 aa), His-SUMO-tagged
| Cat.No. : | INS1-2436R |
| Product Overview : | Recombinant Rat INS1 Protein (25-54 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 25-54 aa |
| Description : | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 19.4 kDa |
| AA Sequence : | FVKQHLCGPHLVEALYLVCGERGFFYTPKS |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Ins1 insulin 1 [ Rattus norvegicus ] |
| Official Symbol | INS1 |
| Synonyms | INS1; insulin 1; insulin-1; |
| Gene ID | 24505 |
| mRNA Refseq | NM_019129 |
| Protein Refseq | NP_062002 |
| UniProt ID | P01322 |
| ◆ Recombinant Proteins | ||
| Proinsulln-01M | Recombinant Mouse Proinsulin (25-108aa) | +Inquiry |
| INS1-2256M | Recombinant Mouse INS1 Protein (25-108 aa), His-Myc-tagged | +Inquiry |
| INS1-63M | Recombinant Mouse INS1 Protein, His/Myc-tagged | +Inquiry |
| RFL19133SF | Recombinant Full Length Schizosaccharomyces Pombe Insig Family Protein(Ins1) Protein, His-Tagged | +Inquiry |
| INS1-3076R | Recombinant Rat INS1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INS1 Products
Required fields are marked with *
My Review for All INS1 Products
Required fields are marked with *
