Recombinant Rat INS1 Protein (25-54 aa), His-SUMO-tagged

Cat.No. : INS1-2436R
Product Overview : Recombinant Rat INS1 Protein (25-54 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His&SUMO
Protein Length : 25-54 aa
Description : Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 19.4 kDa
AA Sequence : FVKQHLCGPHLVEALYLVCGERGFFYTPKS
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Ins1 insulin 1 [ Rattus norvegicus ]
Official Symbol INS1
Synonyms INS1; insulin 1; insulin-1;
Gene ID 24505
mRNA Refseq NM_019129
Protein Refseq NP_062002
UniProt ID P01322

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INS1 Products

Required fields are marked with *

My Review for All INS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon