Recombinant Mouse Itpr3 protein
Cat.No. : | Itpr3-5107M |
Product Overview : | Recombinant Mouse Itpr3 protein(P70227)(2517-2670 aa) was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Mammalian cells |
Tag : | Non |
Protein Length : | 2517-2670 aa |
Form : | Tris/PBS-based buffer, 6% Trehalose. |
AASequence : | DTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRV KNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSGEGEGEQNEIRILQEKLGSTMKLVS HLTSQLNELKEQMTEQRKRRQRLGFVDVQNCMSR |
Purity : | >85% (SDS-PAGE) |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Itpr3 inositol 1,4,5-triphosphate receptor 3 [ Mus musculus ] |
Official Symbol | Itpr3 |
Synonyms | ITPR3; inositol 1,4,5-triphosphate receptor 3; inositol 1,4,5-trisphosphate receptor type 3; IP3R 3; insP3R3; IP3 receptor; type 3 InsP3 receptor; type 3 inositol 1,4,5-trisphosphate receptor; Ip3r3; Itpr-3; |
Gene ID | 16440 |
mRNA Refseq | NM_080553 |
Protein Refseq | NP_542120 |
◆ Recombinant Proteins | ||
Itpr3-5107M | Recombinant Mouse Itpr3 protein | +Inquiry |
Itpr3-5105M | Recombinant Mouse Itpr3 protein, Avi-tagged, Biotinylated | +Inquiry |
Itpr3-5106M | Recombinant Mouse Itpr3 protein | +Inquiry |
Itpr3-5104M | Recombinant Mouse Itpr3 protein | +Inquiry |
ITPR3-4656M | Recombinant Mouse ITPR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Itpr3 Products
Required fields are marked with *
My Review for All Itpr3 Products
Required fields are marked with *