Recombinant Mouse Jag1 Protein, His-Sumo/MYC-tagged
| Cat.No. : | Jag1-1264M |
| Product Overview : | Recombinant Mouse Jag1 protein (33-334aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 33-334 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 53.6 kDa |
| AA Sequence : | GQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Jag1 jagged 1 [ Mus musculus (house mouse) ] |
| Official Symbol | Jag1 |
| Synonyms | Htu; Ozz; ABE2; Ser-1; Gsfabe2; Jag1 |
| Gene ID | 16449 |
| mRNA Refseq | NM_013822.5 |
| Protein Refseq | NP_038850.1 |
| UniProt ID | Q9QXX0 |
| ◆ Recombinant Proteins | ||
| JAG1-2374H | Recombinant Human JAG1 Protein (Gly33-Asp250), His tagged | +Inquiry |
| JAG1-1763R | Recombinant Rhesus Monkey JAG1 Protein, hIgG4-tagged | +Inquiry |
| Jag1-3625M | Recombinant Mouse Jag1 Protein, Myc/DDK-tagged | +Inquiry |
| JAG1-338H | Recombinant Human JAG1 Protein, His-tagged | +Inquiry |
| JAG1-566H | Recombinant Human JAG1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| JAG1-2382HCL | Recombinant Human JAG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Jag1 Products
Required fields are marked with *
My Review for All Jag1 Products
Required fields are marked with *



