Recombinant Mouse Lta protein, His-tagged

Cat.No. : Lta-4368M
Product Overview : Recombinant Mouse Lta protein(P09225)(34-202aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 34-202aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 23.8 kDa
AA Sequence : LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name Lta lymphotoxin A [ Mus musculus ]
Official Symbol Lta
Synonyms LTA; lymphotoxin A; lymphotoxin-alpha; TNF beta; lymphotoxin alpha; tumor necrosis factor ligand superfamily member 1; LT; Ltx; Tnfb; LT[a]; LT-[a]; TNFSF1; hlb382; LTalpha; Tnfsf1b; LT-alpha; TNF-beta; MGC117668;
Gene ID 16992
mRNA Refseq NM_010735
Protein Refseq NP_034865

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Lta Products

Required fields are marked with *

My Review for All Lta Products

Required fields are marked with *

0
cart-icon