Recombinant Mouse Muc1 protein, His-tagged
Cat.No. : | Muc1-4715M |
Product Overview : | Recombinant Mouse Muc1 protein(Q02496)(21-535 aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 21-535 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 52.9 kDa |
AASequence : | FLALPSEENSVTSSQDTSSSLASTTTPVHSSNSDPATRPPGDSTSSPVQSSTSSPATRAPEDSTSTAVLSGTSSPATTAPVNSASSPVAHGDTSSPATSLSKDSNSSPVVHSGTSSAATTAPVDSTSSPVVHGGTSSPATSPPGDSTSSPDHSSTSSPATRAPEDSTSTAVLSGTSSPATTAPVDSTSSPVAHDDTSSPATSLSEDSASSPVAHGGTSSPATSPLRDSTSSPVHSSASIQNIKTTSDLASTPDHNGTSVTTTSSALGSATSPDHSGTSTTTNSSESVLATTPVYSSMPFSTTKVTSGSAIIPDHNGSSVLPTSSVLGSATSLVYNTSAIATTPVSNGTQPSVPSQYPVSPTMATTSSHSTIASSSYYSTVPFSTFSSNSSPQLSVGVSFFFLSFYIQNHPFNSSLEDPSSNYYQELKRNISGLFLQIFNGDFLGISSIKFRSGSVVVESTVVFREGTFSASDVKSQLIQHKKEADDYNLTISEVKVNEMQFPPSAQSRPGVPGWG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | Muc1 mucin 1, transmembrane [ Mus musculus ] |
Official Symbol | Muc1 |
Synonyms | MUC1; mucin 1, transmembrane; mucin-1; episialin; EMA; CD227; Muc-1; |
Gene ID | 17829 |
mRNA Refseq | NM_013605 |
Protein Refseq | NP_038633 |
◆ Recombinant Proteins | ||
MUC1-213H | Recombinant Human MUC1 Protein, DYKDDDDK-tagged | +Inquiry |
MUC1-211H | Recombinant Human MUC1 Protein, DYKDDDDK-tagged | +Inquiry |
MUC1-1349H | Recombinant Human MUC1 Protein (Ser24-Pro146), N-His tagged | +Inquiry |
MUC1-620H | Recombinant Human MUC1(Pro24-Gly167) Protein, C-Fc-Avi-tagged, Biotinylated | +Inquiry |
MUC1-386H | Recombinant Human MUC1 Protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
MUC1-376H | Active Native Human MUC1 | +Inquiry |
MUC1-135B | Native Bovine MUC1 Protein | +Inquiry |
MUC1-4770H | Active Native Human MUC1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MUC1-1980HCL | Recombinant Human MUC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Muc1 Products
Required fields are marked with *
My Review for All Muc1 Products
Required fields are marked with *