Recombinant Mouse Muc1 protein, His-tagged
| Cat.No. : | Muc1-4715M |
| Product Overview : | Recombinant Mouse Muc1 protein(Q02496)(21-535 aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 21-535 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 52.9 kDa |
| AASequence : | FLALPSEENSVTSSQDTSSSLASTTTPVHSSNSDPATRPPGDSTSSPVQSSTSSPATRAPEDSTSTAVLSGTSSPATTAPVNSASSPVAHGDTSSPATSLSKDSNSSPVVHSGTSSAATTAPVDSTSSPVVHGGTSSPATSPPGDSTSSPDHSSTSSPATRAPEDSTSTAVLSGTSSPATTAPVDSTSSPVAHDDTSSPATSLSEDSASSPVAHGGTSSPATSPLRDSTSSPVHSSASIQNIKTTSDLASTPDHNGTSVTTTSSALGSATSPDHSGTSTTTNSSESVLATTPVYSSMPFSTTKVTSGSAIIPDHNGSSVLPTSSVLGSATSLVYNTSAIATTPVSNGTQPSVPSQYPVSPTMATTSSHSTIASSSYYSTVPFSTFSSNSSPQLSVGVSFFFLSFYIQNHPFNSSLEDPSSNYYQELKRNISGLFLQIFNGDFLGISSIKFRSGSVVVESTVVFREGTFSASDVKSQLIQHKKEADDYNLTISEVKVNEMQFPPSAQSRPGVPGWG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | Muc1 mucin 1, transmembrane [ Mus musculus ] |
| Official Symbol | Muc1 |
| Synonyms | MUC1; mucin 1, transmembrane; mucin-1; episialin; EMA; CD227; Muc-1; |
| Gene ID | 17829 |
| mRNA Refseq | NM_013605 |
| Protein Refseq | NP_038633 |
| ◆ Recombinant Proteins | ||
| MUC1-2661H | Recombinant Human MUC1 protein(31-150 aa), C-His-tagged | +Inquiry |
| MUC1-7865H | Recombinant Human MUC1 protein, His-tagged | +Inquiry |
| MUC1-386H | Recombinant Human MUC1 Protein, Fc-tagged | +Inquiry |
| MUC1-0496H | Recombinant Human MUC1 protein, mFc-tagged | +Inquiry |
| MUC1-342HAF647 | Recombinant Human MUC1 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| ◆ Native Proteins | ||
| MUC1-376H | Active Native Human MUC1 | +Inquiry |
| MUC1-4770H | Active Native Human MUC1 Protein | +Inquiry |
| MUC1-135B | Native Bovine MUC1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MUC1-1980HCL | Recombinant Human MUC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Muc1 Products
Required fields are marked with *
My Review for All Muc1 Products
Required fields are marked with *



