Recombinant Mouse NID1 Protein, His-tagged
Cat.No. : | NID1-1294M |
Product Overview : | Recombinant Mouse NID1 Protein (428-665aa) was expressed in Yeast with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 428-665 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 28.3 kDa |
AA Sequence : | SPQRVNGKVKGRIFVGSSQVPVVFENTDLHSYVVMNHGRSYTAISTIPETVGYSLLPLAPIGGIIGWMFA VEQDGFKNGFSITGGEFTRQAEVTFLGHPGKLVLKQQFSGIDEHGHLTISTELEGRVPQIPYGASVHIEP YTELYHYSSSVITSSSTREYTVMEPDQDGAAPSHTHIYQWRQTITFQECAHDDARPALPSTQQLSVDSVF VLYNKEERILRYALSNSIGPVRDGSPDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Nid1 nidogen 1 [ Mus musculus ] |
Official Symbol | NID1 |
Synonyms | NID1; Nid; entactin; nidogen-1; A630025O17; entactin-1 |
Gene ID | 18073 |
mRNA Refseq | NM_010917.2 |
Protein Refseq | NP_035047.2 |
UniProt ID | P10493 |
◆ Recombinant Proteins | ||
NID1-0185H | Recombinant Human NID1 protein, MYC/DDK-tagged | +Inquiry |
NID1-3067H | Recombinant Human NID1 protein, His-tagged | +Inquiry |
NID1-1904HFL | Recombinant Full Length Human NID1 protein, Flag-tagged | +Inquiry |
NID1-6061M | Recombinant Mouse NID1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NID1-3622H | Recombinant Human NID1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NID1-3829HCL | Recombinant Human NID1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NID1 Products
Required fields are marked with *
My Review for All NID1 Products
Required fields are marked with *