Recombinant Mouse NKX2-2 Protein (1-273 aa), His-SUMO-tagged
Cat.No. : | NKX2-2-1766M |
Product Overview : | Recombinant Mouse NKX2-2 Protein (1-273 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-273 aa |
Description : | Acts as a transcriptional activator. Required for the maintenance of NEUROD1 expression in the horomone-producing endocrine cells of the pancreas. May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Associates with chromatin at the NEUROD1 promoter region. Binds to a subset of consensus elements within the NEUROD1 promoter. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 46.1 kDa |
AA Sequence : | MSLTNTKTGFSVKDILDLPDTNDEDGSVAEGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLASTEGLQYSLHGLAASAPPQDSSSKSPEPSADESPDNDKETQGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Nkx2-2 NK2 transcription factor related, locus 2 (Drosophila) [ Mus musculus ] |
Official Symbol | NKX2-2 |
Synonyms | NKX2-2; homeobox protein Nkx2-2; Nkx2.2; tinman; Nkx-2.2; |
Gene ID | 18088 |
mRNA Refseq | NM_001077632 |
Protein Refseq | NP_001071100 |
UniProt ID | P42586 |
◆ Recombinant Proteins | ||
NKX2-2-1303H | Recombinant Human NKX2-2, GST-tagged | +Inquiry |
NKX2-2-153H | Recombinant Human NK2 homeobox 2 Protein, His&Flag&StrepII tagged | +Inquiry |
NKX2-2-5896H | Recombinant Human NKX2-2 Protein, GST-tagged | +Inquiry |
NKX2-2-1766M | Recombinant Mouse NKX2-2 Protein (1-273 aa), His-SUMO-tagged | +Inquiry |
NKX2-2-6676HF | Recombinant Full Length Human NKX2-2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NKX2-2 Products
Required fields are marked with *
My Review for All NKX2-2 Products
Required fields are marked with *
0
Inquiry Basket