Recombinant Mouse Prkaa1 protein, His-tagged
Cat.No. : | Prkaa1-4504M |
Product Overview : | Recombinant Mouse Prkaa1 protein(Q5EG47)(1-312aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-312aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.8 kDa |
AA Sequence : | MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRAAIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Prkaa1 protein kinase, AMP-activated, alpha 1 catalytic subunit [ Mus musculus ] |
Official Symbol | Prkaa1 |
Synonyms | PRKAA1; protein kinase, AMP-activated, alpha 1 catalytic subunit; 5-AMP-activated protein kinase catalytic subunit alpha-1; AMPK subunit alpha-1; tau-protein kinase PRKAA1; AMP-activated protein kinase, alpha 1 catalytic subunit; AI194361; AI450832; AL024255; AMPKalpha1; C130083N04Rik; |
Gene ID | 105787 |
mRNA Refseq | NM_001013367 |
Protein Refseq | NP_001013385 |
◆ Recombinant Proteins | ||
PRKAA1-77H | Active Recombinant Human AMPK (A1/B2/G3), GST-His-tagged | +Inquiry |
Prkaa1-285M | Recombinant Mouse Prkaa1 Protein, MYC/DDK-tagged | +Inquiry |
PRKAA1-1007HFL | Recombinant Full Length Human PRKAA1 Protein, C-Flag-tagged | +Inquiry |
Prkaa1-2311M | Recombinant Mouse Prkaa1 protein, GST&His-tagged | +Inquiry |
PRKAA1-373H | Recombinant Human PRKAA1 protein, His/MBP-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKAA1-1412HCL | Recombinant Human PRKAA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Prkaa1 Products
Required fields are marked with *
My Review for All Prkaa1 Products
Required fields are marked with *
0
Inquiry Basket