Recombinant Mouse Prkaa1 protein, His-tagged
| Cat.No. : | Prkaa1-4504M |
| Product Overview : | Recombinant Mouse Prkaa1 protein(Q5EG47)(1-312aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-312aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 39.8 kDa |
| AA Sequence : | MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRAAIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFE |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Prkaa1 protein kinase, AMP-activated, alpha 1 catalytic subunit [ Mus musculus ] |
| Official Symbol | Prkaa1 |
| Synonyms | PRKAA1; protein kinase, AMP-activated, alpha 1 catalytic subunit; 5-AMP-activated protein kinase catalytic subunit alpha-1; AMPK subunit alpha-1; tau-protein kinase PRKAA1; AMP-activated protein kinase, alpha 1 catalytic subunit; AI194361; AI450832; AL024255; AMPKalpha1; C130083N04Rik; |
| Gene ID | 105787 |
| mRNA Refseq | NM_001013367 |
| Protein Refseq | NP_001013385 |
| ◆ Recombinant Proteins | ||
| PRKAA1-147H | Recombinant Human PRKAA1 Protein, His-tagged | +Inquiry |
| PRKAA1-1007HFL | Recombinant Full Length Human PRKAA1 Protein, C-Flag-tagged | +Inquiry |
| PRKAA1-4668R | Recombinant Rat PRKAA1 Protein | +Inquiry |
| PRKAA1-01H | Recombinant Human PRKAA1 Protein (K45R), His-tagged | +Inquiry |
| Prkaa1-4504M | Recombinant Mouse Prkaa1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRKAA1-278HKCL | Human PRKAA1 Knockdown Cell Lysate | +Inquiry |
| PRKAA1-1412HCL | Recombinant Human PRKAA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Prkaa1 Products
Required fields are marked with *
My Review for All Prkaa1 Products
Required fields are marked with *



