Recombinant Mouse Prkaa1 protein, His-tagged

Cat.No. : Prkaa1-4504M
Product Overview : Recombinant Mouse Prkaa1 protein(Q5EG47)(1-312aa), fused to N-terminal His tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-312aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 39.8 kDa
AA Sequence : MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRAAIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFE
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Prkaa1 protein kinase, AMP-activated, alpha 1 catalytic subunit [ Mus musculus ]
Official Symbol Prkaa1
Synonyms PRKAA1; protein kinase, AMP-activated, alpha 1 catalytic subunit; 5-AMP-activated protein kinase catalytic subunit alpha-1; AMPK subunit alpha-1; tau-protein kinase PRKAA1; AMP-activated protein kinase, alpha 1 catalytic subunit; AI194361; AI450832; AL024255; AMPKalpha1; C130083N04Rik;
Gene ID 105787
mRNA Refseq NM_001013367
Protein Refseq NP_001013385

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Prkaa1 Products

Required fields are marked with *

My Review for All Prkaa1 Products

Required fields are marked with *

0
cart-icon