Recombinant Mouse Prnp Protein

Cat.No. : Prnp-289M
Product Overview : Recombinant Mouse Prnp(23-231 aa) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 23-231 aa
Description : Prion Protein (PrP) is an abundant cellular protein in mammalian neural tissue. It is associated with mammalian prion diseases, e.g. transmissible spongiforme encephalophathies that include human Creutzfeld-Jakob disease, bovine spongiforme encephalopathy, sheep scrapie, cervid’s chronic wasting disease and various rodent prion diseases. In the disease process, PrP undergoes protein aggregation into disease specific PrPSc.
Form : Finally dialysed in pure water, shock frozen in liquid nitrogen at a protein concentration of 0.25 mg/ml.
Molecular Mass : 23163 kg/mol
AA Sequence : GSKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWED
RYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSS
Purity : > 95% by SDS-PAGE
Applications : Prion Protein is frequently used in analytical aggregation assays
Notes : Thawing: Gentle agitation at 37 centigrade until no ice is left. Keep on ice. Do not refreeze
Storage : Store at -80 centigrade
Concentration : 0.25 mg/ml
Gene Name Prnp prion protein [ Mus musculus ]
Official Symbol Prnp
Synonyms PRNP; prion protein; major prion protein; PrP; PrPC; Sinc; CD230; PrPSc; Prn-i; Prn-p; PrP< C> AA960666; AI325101; prP27-30; prP33-35C;
Gene ID 19122
mRNA Refseq NM_011170
Protein Refseq NP_035300
UniProt ID P04925

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Prnp Products

Required fields are marked with *

My Review for All Prnp Products

Required fields are marked with *

0
cart-icon
0
compare icon