Recombinant Mouse Rcvrn Protein, His-tagged
Cat.No. : | Rcvrn-001M |
Product Overview : | Recombinant Mouse recoverin(33-293aa), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 33-293 a.a. |
Description : | Recoverin also known as Rcvrn, is a heterogeneously acylated calcium-binding and intracellular signal transduction protein in the photoreceptor cells of retina. Recoverin contains four EF-hands, of which two bind Ca. Ca-induced extrusion of the acyl group from a hydrophobic cleft in the protein drives the translocation of recoverin from solution to the disc membrane. Recently, recoverin is a detectable serologic protein that is expressed in patients with cancer-associated retinopathy, a paraneoplastic syndrome. |
Form : | Liquid |
Molecular Mass : | 25.8 kDa |
Purity : | > 90% by SDS - PAGE |
Storage : | Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1.0 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol. 1mM DTT. |
Warning : | For research use only. This product is not intended or approved for human, diagnostics or veterin |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMGNSKSGALSKEILEELQLNTKFTEEELSAWYQSFLKECPSGRITRQEFESIYSKFFPDSDPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTTAGKPTQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMIKPEDVKLLPDDENTPEKRAEKIWAFFGKKEDDKLTEEEFIEGTLANKEILRLIQFEPQKVKERIKEKKQ |
Gene Name | Rcvrn recoverin [ Mus musculus (house mouse) ] |
Official Symbol | Rcvrn |
Synonyms | CAR; S-modulin; recoverin; 23 kDa photoreceptor cell-specific protein; cancer-associated retinopathy protein; guanylate cyclase activator |
Gene ID | 19674 |
mRNA Refseq | NM_009038 |
Protein Refseq | NP_033064 |
UniProt ID | P34057 |
◆ Recombinant Proteins | ||
RCVRN-6160H | Recombinant Human RCVRN Protein (Gly2-Ala200), His tagged | +Inquiry |
RCVRN-5057H | Recombinant Human RCVRN protein, His&Myc-tagged | +Inquiry |
RCVRN-3835R | Recombinant Rhesus monkey RCVRN Protein, His-tagged | +Inquiry |
RCVRN-1870H | Recombinant Human RCVRN Protein, His (Fc)-Avi-tagged | +Inquiry |
RCVRN-191H | Recombinant Human Recoverin | +Inquiry |
◆ Cell & Tissue Lysates | ||
RCVRN-2442HCL | Recombinant Human RCVRN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Rcvrn Products
Required fields are marked with *
My Review for All Rcvrn Products
Required fields are marked with *
0
Inquiry Basket