Recombinant Mouse Rcvrn Protein, His-tagged

• Cat.No.: Rcvrn-001M
• Product Overview: Recombinant Mouse recoverin(33-293aa), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 33-293 a.a.
• Description: Recoverin also known as Rcvrn, is a heterogeneously acylated calcium-binding and intracellular signal transduction protein in the photoreceptor cells of retina. Recoverin contains four EF-hands, of which two bind Ca. Ca-induced extrusion of the acyl group from a hydrophobic cleft in the protein drives the translocation of recoverin from solution to the disc membrane. Recently, recoverin is a detectable serologic protein that is expressed in patients with cancer-associated retinopathy, a paraneoplastic syndrome.
• Form: Liquid
• Molecular Mass: 25.8 kDa
• Purity: > 90% by SDS - PAGE
• Storage: Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1.0 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol. 1mM DTT.
• Warning: For research use only. This product is not intended or approved for human, diagnostics or veterin
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMGNSKSGALSKEILEELQLNTKFTEEELSAWYQSFLKECPSGRITRQEFESIYSKFFPDSDPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTTAGKPTQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMIKPEDVKLLPDDENTPEKRAEKIWAFFGKKEDDKLTEEEFIEGTLANKEILRLIQFEPQKVKERIKEKKQ

Gene Information

• Gene Name: Rcvrn recoverin [ Mus musculus (house mouse) ]
• Official Symbol: Rcvrn
• Synonyms: CAR; S-modulin; recoverin; 23 kDa photoreceptor cell-specific protein; cancer-associated retinopathy protein; guanylate cyclase activator
• Gene ID: 19674
• mRNA Refseq: NM_009038
• Protein Refseq: NP_033064
• UniProt ID: P34057