Recombinant Mouse S100a9 protein, His-SUMO-tagged
| Cat.No. : | S100a9-3466M |
| Product Overview : | Recombinant Mouse S100a9 protein(P31725)(2-113aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-113aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28.9 kDa |
| AA Sequence : | ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | S100a9 S100 calcium binding protein A9 (calgranulin B) [ Mus musculus ] |
| Official Symbol | S100a9 |
| Synonyms | S100A9; S100 calcium binding protein A9 (calgranulin B); protein S100-A9; MRP-14; calgranulin-B; leukocyte L1 complex heavy chain; migration inhibitory factor-related protein 14; S100 calcium-binding protein A9 (calgranulin B); p14; Cagb; GAGB; L1Ag; BEE22; MRP14; 60B8Ag; AW546964; |
| Gene ID | 20202 |
| mRNA Refseq | NM_009114 |
| Protein Refseq | NP_033140 |
| ◆ Recombinant Proteins | ||
| S100A9-300H | Active Recombinant Human S100A9, His-tagged | +Inquiry |
| S100A9-6221H | Recombinant Human S100A9 Protein (Thr2-Pro114), N-His tagged | +Inquiry |
| S100A9-433H | Recombinant Human S100 Calcium Binding Protein A9, Cys3Ser Mutated | +Inquiry |
| S100A9-1019H | Active Recombinant Human Calprotectin S100A9 Protein | +Inquiry |
| S100A9-1805C | Recombinant Cattle S100A9 protein, His & T7-tagged | +Inquiry |
| ◆ Native Proteins | ||
| S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| S100A9-684HCL | Recombinant Human S100A9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100a9 Products
Required fields are marked with *
My Review for All S100a9 Products
Required fields are marked with *
