Recombinant Mouse SNCB Protein (1-133 aa)

• Cat.No.: SNCB-2457M
• Product Overview: Recombinant Mouse SNCB Protein (1-133 aa) is produced by E. coli expression system. Protein Description: Full Length.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 1-133 aa
• Description: May be involved in neuronal plasticity.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 14.1 kDa
• AA Sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTSGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKKEEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDSPQEEYQEYEPEA
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Sncb synuclein, beta [ Mus musculus ]
• Official Symbol: SNCB
• Synonyms: SNCB; synuclein, beta; beta-synuclein; betaSYN; AI838531
• Gene ID: 104069
• mRNA Refseq: NM_033610
• Protein Refseq: NP_291088
• UniProt ID: Q91ZZ3