Recombinant Mouse SNCB Protein (1-133 aa)
| Cat.No. : | SNCB-2457M |
| Product Overview : | Recombinant Mouse SNCB Protein (1-133 aa) is produced by E. coli expression system. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 1-133 aa |
| Description : | May be involved in neuronal plasticity. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 14.1 kDa |
| AA Sequence : | MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTSGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKKEEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDSPQEEYQEYEPEA |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Sncb synuclein, beta [ Mus musculus ] |
| Official Symbol | SNCB |
| Synonyms | SNCB; synuclein, beta; beta-synuclein; betaSYN; AI838531; |
| Gene ID | 104069 |
| mRNA Refseq | NM_033610 |
| Protein Refseq | NP_291088 |
| UniProt ID | Q91ZZ3 |
| ◆ Recombinant Proteins | ||
| SNCB-4366R | Recombinant Rhesus monkey SNCB Protein, His-tagged | +Inquiry |
| SNCB-2879H | Recombinant Human SNCB protein(1-134aa), His&Myc-tagged | +Inquiry |
| SNCB-5006H | Recombinant Human SNCB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SNCB-245H | Recombinant Human SNCB Protein, MYC/DDK-tagged | +Inquiry |
| SNCB-2056H | Recombinant Human SNCB Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| SNCB-27206TH | Native Human SNCB | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNCB-1632HCL | Recombinant Human SNCB 293 Cell Lysate | +Inquiry |
| SNCB-1631HCL | Recombinant Human SNCB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCB Products
Required fields are marked with *
My Review for All SNCB Products
Required fields are marked with *
