Recombinant Mouse SNCB Protein (1-133 aa)
Cat.No. : | SNCB-2457M |
Product Overview : | Recombinant Mouse SNCB Protein (1-133 aa) is produced by E. coli expression system. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1-133 aa |
Description : | May be involved in neuronal plasticity. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 14.1 kDa |
AA Sequence : | MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTSGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKKEEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDSPQEEYQEYEPEA |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Sncb synuclein, beta [ Mus musculus ] |
Official Symbol | SNCB |
Synonyms | SNCB; synuclein, beta; beta-synuclein; betaSYN; AI838531; |
Gene ID | 104069 |
mRNA Refseq | NM_033610 |
Protein Refseq | NP_291088 |
UniProt ID | Q91ZZ3 |
◆ Recombinant Proteins | ||
SNCB-5639R | Recombinant Rat SNCB Protein | +Inquiry |
SNCB-245H | Recombinant Human SNCB Protein, MYC/DDK-tagged | +Inquiry |
SNCB-4366R | Recombinant Rhesus monkey SNCB Protein, His-tagged | +Inquiry |
SNCB-246H | Recombinant Human SNCB, His-tagged | +Inquiry |
SNCB-1294HFL | Recombinant Full Length Human SNCB Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
SNCB-27206TH | Native Human SNCB | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNCB-1632HCL | Recombinant Human SNCB 293 Cell Lysate | +Inquiry |
SNCB-1631HCL | Recombinant Human SNCB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCB Products
Required fields are marked with *
My Review for All SNCB Products
Required fields are marked with *