Recombinant Mouse Tnfrsf13c Protein, Fc-tagged
Cat.No. : | Tnfrsf13c-099M |
Product Overview : | Recombinant Mouse Tnfrsf13c protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 175 |
Description : | Predicted to enable signaling receptor activity. Acts upstream of or within several processes, including positive regulation of germinal center formation; positive regulation of interferon-gamma production; and positive regulation of lymphocyte activation. Located in external side of plasma membrane. Is expressed in genitourinary system; hemolymphoid system gland; lung; and retina. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human TNFRSF13C (TNF receptor superfamily member 13C). |
Form : | Lyophilized |
Molecular Mass : | 33.3 kDa |
AA Sequence : | MGARRLRVRSQRSRDSSVPTQCNQTECFDPLVRNCVSCELFHTPDTGHTSSLEPGTALQPQEGSALRPDVALLVGAPALLGLILALTLVGLVSLVSWRWRQQLRTASPDTSEGVQQESLENVFVPSSETPHASAPTWPPLKEDADSALPRHSVPVPATELGSTELVTTKTAGPEQ |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Tnfrsf13c tumor necrosis factor receptor superfamily, member 13c [ Mus musculus (house mouse) ] |
Official Symbol | Tnfrsf13c |
Synonyms | TNFRSF13C; tumor necrosis factor receptor superfamily, member 13c; tumor necrosis factor receptor superfamily member 13C; BAFF receptor; BLyS receptor 3; B-cell maturation defect 1; B-cell-activating factor receptor; b cell-activating factor receptor; Bcmd; Baffr; Bcmd1; BAFF-R; Bcmd-1; Lvis22; 2010006P15Rik; MGC123890; MGC123891; |
Gene ID | 72049 |
mRNA Refseq | NM_028075 |
Protein Refseq | NP_082351 |
UniProt ID | Q9D8D0 |
◆ Recombinant Proteins | ||
TNFRSF13C-2911M | Active Recombinant Mouse TNFRSF13C protein, Fc-tagged | +Inquiry |
Tnfrsf13c-1820M | Active Recombinant Mouse Tnfrsf13c protein, Fc & Avi-tagged, Biotinylated | +Inquiry |
Tnfrsf13c-365R | Recombinant Rat Tnfrsf13c Protein, His-tagged | +Inquiry |
TNFRSF13C-2909H | Recombinant Human TNFRSF13C protein, His-Avi-tagged, Biotinylated | +Inquiry |
TNFRSF13C-25M | Recombinant Mouse BAFF-R, HIgG1, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF13C-1861MCL | Recombinant Mouse TNFRSF13C cell lysate | +Inquiry |
TNFRSF13C-831RCL | Recombinant Rat TNFRSF13C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnfrsf13c Products
Required fields are marked with *
My Review for All Tnfrsf13c Products
Required fields are marked with *