Recombinant Mouse Tnfrsf13c Protein, Fc-tagged

Cat.No. : Tnfrsf13c-099M
Product Overview : Recombinant Mouse Tnfrsf13c protein with Fc tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : Fc
Protein Length : 175
Description : Predicted to enable signaling receptor activity. Acts upstream of or within several processes, including positive regulation of germinal center formation; positive regulation of interferon-gamma production; and positive regulation of lymphocyte activation. Located in external side of plasma membrane. Is expressed in genitourinary system; hemolymphoid system gland; lung; and retina. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human TNFRSF13C (TNF receptor superfamily member 13C).
Form : Lyophilized
Molecular Mass : 33.3 kDa
AA Sequence : MGARRLRVRSQRSRDSSVPTQCNQTECFDPLVRNCVSCELFHTPDTGHTSSLEPGTALQPQEGSALRPDVALLVGAPALLGLILALTLVGLVSLVSWRWRQQLRTASPDTSEGVQQESLENVFVPSSETPHASAPTWPPLKEDADSALPRHSVPVPATELGSTELVTTKTAGPEQ
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Tnfrsf13c tumor necrosis factor receptor superfamily, member 13c [ Mus musculus (house mouse) ]
Official Symbol Tnfrsf13c
Synonyms TNFRSF13C; tumor necrosis factor receptor superfamily, member 13c; tumor necrosis factor receptor superfamily member 13C; BAFF receptor; BLyS receptor 3; B-cell maturation defect 1; B-cell-activating factor receptor; b cell-activating factor receptor; Bcmd; Baffr; Bcmd1; BAFF-R; Bcmd-1; Lvis22; 2010006P15Rik; MGC123890; MGC123891;
Gene ID 72049
mRNA Refseq NM_028075
Protein Refseq NP_082351
UniProt ID Q9D8D0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tnfrsf13c Products

Required fields are marked with *

My Review for All Tnfrsf13c Products

Required fields are marked with *

0
cart-icon
0
compare icon