Recombinant Mouse Ttr protein, His-SUMO-tagged
| Cat.No. : | Ttr-3631M |
| Product Overview : | Recombinant Mouse Ttr protein(P07309)(23-147aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 23-147aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 29.5 kDa |
| AA Sequence : | AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Ttr transthyretin [ Mus musculus ] |
| Official Symbol | Ttr |
| Synonyms | TTR; transthyretin; D17860; AA408768; AI787086; prealbumin; MGC107649; |
| Gene ID | 22139 |
| mRNA Refseq | NM_013697 |
| Protein Refseq | NP_038725 |
| ◆ Recombinant Proteins | ||
| Ttr-3631M | Recombinant Mouse Ttr protein, His-SUMO-tagged | +Inquiry |
| TTR-2530H | Recombinant Human TTR protein(31-130 aa), C-His-tagged | +Inquiry |
| TTR-732R | Recombinant Rabbit TTR protein, His & T7-tagged | +Inquiry |
| TTR-072H | Recombinant Human TTR Protein | +Inquiry |
| TTR-2273H | Recombinant Human TTR Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| TTR-141S | Native Sheep prealbumin | +Inquiry |
| TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
| TTR-31108TH | Native Human TTR | +Inquiry |
| TTR-706H | Native Human Transthyretin | +Inquiry |
| TTR-131H | Native Human Prealbumin protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TTR-2149HCL | Recombinant Human TTR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ttr Products
Required fields are marked with *
My Review for All Ttr Products
Required fields are marked with *



