Recombinant Mouse Vasp protein
| Cat.No. : | Vasp-4907M |
| Product Overview : | Recombinant Mouse Vasp protein(P70460)(2-375 aa) was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | Non |
| Protein Length : | 2-375 aa |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | SETVICSSRATVMLYDDSNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVV INCAIIRGVKYNQATPIFHQWRDARQVWGLNFGSKEDAIQFATGMANALEALEGGGPPPA PAPPAWSAQNGPSPEELEQQKRQPEHMERRVSNAGGPPAPPAGGPPPPPGPPPPPGPPPP PGLPSSGVSGAGHGAGAAPPPAPPLPTAQGPNSGGSGAPGLAAAIAGAKLRKVSKQEEAS GGPLAPKAENSRSTGGGLMEEMNAMLARRRKATQVGEKPPKDESASEESEARLPAQSEPV RRPWEKNSTTLPRMKSSSSVTTSEAHPSTPCSSDDSDLERVKQELLEEVRKELQKMKEEI IEVFVQELRKRGSP |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | Vasp vasodilator-stimulated phosphoprotein [ Mus musculus ] |
| Official Symbol | Vasp |
| Synonyms | VASP; vasodilator-stimulated phosphoprotein; AA107290; |
| Gene ID | 22323 |
| mRNA Refseq | NM_009499 |
| Protein Refseq | NP_033525 |
| ◆ Recombinant Proteins | ||
| VASP-17986M | Recombinant Mouse VASP Protein | +Inquiry |
| Vasp-4910M | Recombinant Mouse Vasp protein | +Inquiry |
| VASP-9999M | Recombinant Mouse VASP Protein, His (Fc)-Avi-tagged | +Inquiry |
| Vasp-4907M | Recombinant Mouse Vasp protein | +Inquiry |
| VASP-1409HFL | Recombinant Full Length Human VASP Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VASP-316HKCL | Human VASP Knockdown Cell Lysate | +Inquiry |
| VASP-426HCL | Recombinant Human VASP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Vasp Products
Required fields are marked with *
My Review for All Vasp Products
Required fields are marked with *
