"WISP2" Related Products

Expand
Expand
Expand

Recombinant Mouse WISP2 Protein (24-251 aa), His-SUMO-tagged

Cat.No. : WISP2-1166M
Product Overview : Recombinant Mouse WISP2 Protein (24-251 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.
Description : May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.
Source : E. coli
Species : Mouse
Tag : His-SUMO
Form : Tris-based buffer,50% glycerol
Molecular Mass : 40.5 kDa
Protein length : 24-251 aa
AA Sequence : QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Figure :

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Gene Name : Wisp2 WNT1 inducible signaling pathway protein 2 [ Mus musculus ]
Official Symbol : WISP2
Synonyms : WISP2; CTGF-L; WISP-2; Ccn5; Crgr4; Ctgfl; Rcop1;
Gene ID : 22403
mRNA Refseq : NM_016873
Protein Refseq : NP_058569
UniProt ID : Q9Z0G4

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.