Recombinant Mouse WISP2 Protein (24-251 aa), His-SUMO-tagged
| Cat.No. : | WISP2-1166M |
| Product Overview : | Recombinant Mouse WISP2 Protein (24-251 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 24-251 aa |
| Description : | May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 40.5 kDa |
| AA Sequence : | QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | Wisp2 WNT1 inducible signaling pathway protein 2 [ Mus musculus ] |
| Official Symbol | WISP2 |
| Synonyms | WISP2; CTGF-L; WISP-2; Ccn5; Crgr4; Ctgfl; Rcop1; |
| Gene ID | 22403 |
| mRNA Refseq | NM_016873 |
| Protein Refseq | NP_058569 |
| UniProt ID | Q9Z0G4 |
| ◆ Recombinant Proteins | ||
| WISP2-644H | Active Recombinant Human WNT1 Inducible Signaling Pathway Protein 2 | +Inquiry |
| WISP2-1754M | Recombinant Mouse WISP2 Protein (24-251 aa), His-tagged | +Inquiry |
| WISP2-6595R | Recombinant Rat WISP2 Protein | +Inquiry |
| WISP2-932H | Recombinant Human WNT1 Inducible Signaling Pathway Protein 2 | +Inquiry |
| WISP2-4630H | Recombinant Human WISP2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WISP2-307HCL | Recombinant Human WISP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WISP2 Products
Required fields are marked with *
My Review for All WISP2 Products
Required fields are marked with *
