Recombinant Mouse WISP2 Protein (24-251 aa), His-SUMO-tagged

Cat.No. : WISP2-1166M
Product Overview : Recombinant Mouse WISP2 Protein (24-251 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 24-251 aa
Description : May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 40.5 kDa
AA Sequence : QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name Wisp2 WNT1 inducible signaling pathway protein 2 [ Mus musculus ]
Official Symbol WISP2
Synonyms WISP2; CTGF-L; WISP-2; Ccn5; Crgr4; Ctgfl; Rcop1;
Gene ID 22403
mRNA Refseq NM_016873
Protein Refseq NP_058569
UniProt ID Q9Z0G4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WISP2 Products

Required fields are marked with *

My Review for All WISP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon