Recombinant Mouse WISP2 Protein (24-251 aa), His-SUMO-tagged
Cat.No. : | WISP2-1166M |
Product Overview : | Recombinant Mouse WISP2 Protein (24-251 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 24-251 aa |
Description : | May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 40.5 kDa |
AA Sequence : | QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | Wisp2 WNT1 inducible signaling pathway protein 2 [ Mus musculus ] |
Official Symbol | WISP2 |
Synonyms | WISP2; CTGF-L; WISP-2; Ccn5; Crgr4; Ctgfl; Rcop1; |
Gene ID | 22403 |
mRNA Refseq | NM_016873 |
Protein Refseq | NP_058569 |
UniProt ID | Q9Z0G4 |
◆ Recombinant Proteins | ||
WISP2-1754M | Recombinant Mouse WISP2 Protein (24-251 aa), His-tagged | +Inquiry |
Wisp2-591R | Recombinant Rat Wisp2 Protein, His-tagged | +Inquiry |
WISP2-6595R | Recombinant Rat WISP2 Protein | +Inquiry |
WISP2-7845Z | Recombinant Zebrafish WISP2 | +Inquiry |
WISP2-30865TH | Recombinant Human WISP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
WISP2-307HCL | Recombinant Human WISP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WISP2 Products
Required fields are marked with *
My Review for All WISP2 Products
Required fields are marked with *