Recombinant Pig IL2RA protein, His-tagged
| Cat.No. : | IL2RA-4695P |
| Product Overview : | Recombinant Pig IL2RA protein(O02733)(22-245 aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pig |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 22-245 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 26.8 kDa |
| AASequence : | GACVQQPPSLRNATFKILGYKVGTTLNCDCQRGFRRDPSSGPYMICRGNSSHSFWENKCQCMPTSSPRIPVKQVTPRPEEQKERKTTETQGQMQPPNQANLPGHCKEPPPWEHESLKRVYHFMEGQTVRYQCLPGFRDGSAQNNSAQSVCKKQEDQEVMRWTQPKLKCKSEKENGSFPEPQMSTAAPPTTKTSLPTRTKGTTDSQNLTEVPATMQPIIFTTQYQ |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | IL2RA interleukin 2 receptor, alpha [ Sus scrofa ] |
| Official Symbol | IL2RA |
| Synonyms | IL2RA; interleukin 2 receptor, alpha; interleukin-2 receptor subunit alpha; IL2-RA; IL-2-RA; IL-2R subunit alpha; IL-2 receptor subunit alpha; interleukin-2 receptor alpha chain; CD25; |
| Gene ID | 396814 |
| mRNA Refseq | NM_213835 |
| Protein Refseq | NP_999000 |
| ◆ Recombinant Proteins | ||
| IL2RA-636HF | Recombinant Human IL2RA Protein, Fc-tagged, FITC conjugated | +Inquiry |
| IL2RA-5198H | Recombinant Human IL2RA Protein | +Inquiry |
| IL2RA-1864C | Recombinant Cattle IL2RA protein, His & T7-tagged | +Inquiry |
| IL2RA-2407H | Recombinant Human IL2RA Protein (Glu22-Gln240), His tagged | +Inquiry |
| IL2RA-5197H | Recombinant Human IL2RA Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL2RA-1015CCL | Recombinant Cynomolgus IL2RA cell lysate | +Inquiry |
| IL2RA-2024MCL | Recombinant Mouse IL2RA cell lysate | +Inquiry |
| IL2RA-2907HCL | Recombinant Human IL2RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL2RA Products
Required fields are marked with *
My Review for All IL2RA Products
Required fields are marked with *
