Recombinant Pig IL2RA protein, His-tagged

• Cat.No.: IL2RA-4695P
• Product Overview: Recombinant Pig IL2RA protein(O02733)(22-245 aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Pig
• Source: Yeast
• Tag: His
• Protein Length: 22-245 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 26.8 kDa
• AASequence: GACVQQPPSLRNATFKILGYKVGTTLNCDCQRGFRRDPSSGPYMICRGNSSHSFWENKCQCMPTSSPRIPVKQVTPRPEEQKERKTTETQGQMQPPNQANLPGHCKEPPPWEHESLKRVYHFMEGQTVRYQCLPGFRDGSAQNNSAQSVCKKQEDQEVMRWTQPKLKCKSEKENGSFPEPQMSTAAPPTTKTSLPTRTKGTTDSQNLTEVPATMQPIIFTTQYQ
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: IL2RA interleukin 2 receptor, alpha [ Sus scrofa ]
• Official Symbol: IL2RA
• Synonyms: IL2RA; interleukin 2 receptor, alpha; interleukin-2 receptor subunit alpha; IL2-RA; IL-2-RA; IL-2R subunit alpha; IL-2 receptor subunit alpha; interleukin-2 receptor alpha chain; CD25
• Gene ID: 396814
• mRNA Refseq: NM_213835
• Protein Refseq: NP_999000