Recombinant Pig IL2RA protein, His-tagged

Cat.No. : IL2RA-4695P
Product Overview : Recombinant Pig IL2RA protein(O02733)(22-245 aa), fused with C-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pig
Source : Yeast
Tag : His
Protein Length : 22-245 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 26.8 kDa
AASequence : GACVQQPPSLRNATFKILGYKVGTTLNCDCQRGFRRDPSSGPYMICRGNSSHSFWENKCQCMPTSSPRIPVKQVTPRPEEQKERKTTETQGQMQPPNQANLPGHCKEPPPWEHESLKRVYHFMEGQTVRYQCLPGFRDGSAQNNSAQSVCKKQEDQEVMRWTQPKLKCKSEKENGSFPEPQMSTAAPPTTKTSLPTRTKGTTDSQNLTEVPATMQPIIFTTQYQ
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name IL2RA interleukin 2 receptor, alpha [ Sus scrofa ]
Official Symbol IL2RA
Synonyms IL2RA; interleukin 2 receptor, alpha; interleukin-2 receptor subunit alpha; IL2-RA; IL-2-RA; IL-2R subunit alpha; IL-2 receptor subunit alpha; interleukin-2 receptor alpha chain; CD25;
Gene ID 396814
mRNA Refseq NM_213835
Protein Refseq NP_999000

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL2RA Products

Required fields are marked with *

My Review for All IL2RA Products

Required fields are marked with *

0
cart-icon
0
compare icon