Recombinant Full Length Rat apolipoprotein E Protein, His tagged

Cat.No. : APOE-726R
Product Overview : Recombinant Full Length Rat apolipoprotein E Protein (1-312 aa) with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Tag : His
Protein Length : 1-312 aa
Description : Enables several functions, including amyloid-beta binding activity; hydroxyapatite binding activity; and phospholipid binding activity. Involved in several processes, including cellular response to alcohol; neurogenesis; and regulation of lipid metabolic process. Located in several cellular components, including endosome; microtubule; and neuronal cell body. Is extrinsic component of external side of plasma membrane. Part of several cellular components, including discoidal high-density lipoprotein particle; low-density lipoprotein particle; and triglyceride-rich plasma lipoprotein particle. Used to study artery disease (multiple); familial hyperlipidemia (multiple); glomerulosclerosis; middle cerebral artery infarction; and steatotic liver disease (multiple). Biomarker of several diseases, including glomerulonephritis (multiple); hyperhomocysteinemia; hypertension; sciatic neuropathy; and transient cerebral ischemia. Human ortholog(s) of this gene implicated in several diseases, including Alzheimer''s disease (multiple); artery disease (multiple); biliary tract cancer (multiple); eye disease (multiple); and familial hyperlipidemia (multiple). Orthologous to human APOE (apolipoprotein E).
Molecular Mass : 34 kDa
AA Sequence : EGELEVTDQLPGQSDQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTVLMEDTMTEVKAYKKELEEQLGPVAEETRARLAKEVQAAQARLGADMEDLRNRLGQYRNEVNTMLGQSTEELRSRLSTHLRKMRKRLMRDADDLQKRLAVYKAGAQEGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQALSDRIRGRLEEVGNQARDRLEEVREQMEEVRSKMEEQTQQIRLQAEIFQARIKGWFEPLVEDMQRQWANLMEKIQASVATNSIASTTVPLENQHHHHHH
Endotoxin : < 1 EU/μg by LAL.
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 1 mg/mL by BCA
Gene Name Apoe apolipoprotein E [ Rattus norvegicus (Norway rat) ]
Official Symbol APOE
Synonyms APOE; apolipoprotein E; apo-E; APOEA;
Gene ID 25728
mRNA Refseq NM_138828
Protein Refseq NP_620183
UniProt ID P02650

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOE Products

Required fields are marked with *

My Review for All APOE Products

Required fields are marked with *

0
cart-icon
0
compare icon