Recombinant Rat Ccl22 protein

Cat.No. : Ccl22-637R
Product Overview : Recombinant Rat Ccl22 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 68
Description : CCL22 is a protein encoded by the CCL22 gene. It is highly expressed in macrophage, monocyte-derived dendritic cell and thymus, additionally, also detected in the tissues of thymus, lymph node and appendix. CCL22 can bind to CCR4, and is a chemoattractant for monocytes, monocyte-derived dendritic cells, and natural killer cells, but not for neutrophils, eosinophils, and resting T-lymphocytes. After secreted from monocyte-derived dendritic cells, the protein can be proteolytic cleaved into three forms: MDC (3-69), MDC (5-69), MDC (7-69).
Form : Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100 ng/ml.
Molecular Mass : Approximately 7.9 kDa, a single, non-glycosylated polypeptide chain containing 68 amino acids.
AA Sequence : GPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSCRKPGVVLITIKNRDICADPRMLWVKKILHKLA
Endotoxin : Less than 1 EU/µg of rRtMDC/CCL22 as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Ccl22
Official Symbol Ccl22
Synonyms CCL22; chemokine (C-C motif) ligand 22; C-C motif chemokine 22; small inducible cytokine A22; small inducible cytokine subfamily A (Cys-Cys) member 22; small inducible cytokine subfamily A (Cys-Cys), member 22; Mdc; Scya22; MGC108943;
Gene ID 117551
mRNA Refseq NM_057203
Protein Refseq NP_476551
UniProt ID Q5I0L5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl22 Products

Required fields are marked with *

My Review for All Ccl22 Products

Required fields are marked with *

0
cart-icon