Recombinant Rat CLEC12A Protein, His-tagged

• Cat.No.: CLEC12A-102R
• Product Overview: Recombinant Rat CLEC12A Protein, fused to His-tag, was expressed in HEK293.

Specification

• Species: Rat
• Source: HEK293
• Tag: His
• Description: Predicted to be integral component of membrane. Orthologous to human CLEC12A (C-type lectin domain family 12 member A).
• Form: Supplied as a 0.2 μm filtered solution in PBS , pH7.4.
• Molecular Mass: ~26.2 kDa
• AA Sequence: MHSSALLCCLVLLTGVRAETEMIKSNQLQRVKEELQENVSLQLMHNLNNSKKIKTLSAMLQNIATQLCQELSKKEPGHKCKPCPKASDWYKDSCYSRFQKYATWQESVEFCSARNASLLKVKNKDELEFIKSKELYNYWLALPPSKMYRSYELLSEKMFLSEGFKRSTYDITKMSCGFIRGEYVYYTNCDEEKYTMCEETASKVQVESVLSDLPEGSILHHHHHH
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.417 mg/mL

Gene Information

• Gene Name: Clec12a C-type lectin domain family 12, member A [ Rattus norvegicus (Norway rat) ]
• Official Symbol: CLEC12A
• Synonyms: CLL1; MICL; CD371; CLL-1; DCAL-2
• Gene ID: 680338
• mRNA Refseq: NM_001134716
• Protein Refseq: NP_001128188
• UniProt ID: B4F798