Recombinant Rat CLEC12A Protein, His-tagged
| Cat.No. : | CLEC12A-102R |
| Product Overview : | Recombinant Rat CLEC12A Protein, fused to His-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | HEK293 |
| Tag : | His |
| Description : | Predicted to be integral component of membrane. Orthologous to human CLEC12A (C-type lectin domain family 12 member A). |
| Form : | Supplied as a 0.2 μm filtered solution in PBS , pH7.4. |
| Molecular Mass : | ~26.2 kDa |
| AA Sequence : | MHSSALLCCLVLLTGVRAETEMIKSNQLQRVKEELQENVSLQLMHNLNNSKKIKTLSAMLQNIATQLCQELSKKEPGHKCKPCPKASDWYKDSCYSRFQKYATWQESVEFCSARNASLLKVKNKDELEFIKSKELYNYWLALPPSKMYRSYELLSEKMFLSEGFKRSTYDITKMSCGFIRGEYVYYTNCDEEKYTMCEETASKVQVESVLSDLPEGSILHHHHHH |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.417 mg/mL |
| Gene Name | Clec12a C-type lectin domain family 12, member A [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | CLEC12A |
| Synonyms | CLL1; MICL; CD371; CLL-1; DCAL-2 |
| Gene ID | 680338 |
| mRNA Refseq | NM_001134716 |
| Protein Refseq | NP_001128188 |
| UniProt ID | B4F798 |
| ◆ Recombinant Proteins | ||
| CLEC12A-2948H | Recombinant Human CLEC12A protein, His,Avi-tagged, Biotinylated | +Inquiry |
| CLEC12A-4689H | Active Recombinant Human CLEC12A Protein, His-tagged, Site-specific PE-Labeled | +Inquiry |
| CLEC12A-2947H | Active Recombinant Human CLEC12A protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
| CLEC12A-1455H | Recombinant Human CLEC12A Protein | +Inquiry |
| CLEC12A-2757M | Recombinant Mouse CLEC12A Protein (65-267 aa), His-Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLEC12A-1920HCL | Recombinant Human CLEC12A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC12A Products
Required fields are marked with *
My Review for All CLEC12A Products
Required fields are marked with *
