Recombinant Rat CLEC12A Protein, His-tagged

Cat.No. : CLEC12A-102R
Product Overview : Recombinant Rat CLEC12A Protein, fused to His-tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Tag : His
Description : Predicted to be integral component of membrane. Orthologous to human CLEC12A (C-type lectin domain family 12 member A).
Form : Supplied as a 0.2 μm filtered solution in PBS , pH7.4.
Molecular Mass : ~26.2 kDa
AA Sequence : MHSSALLCCLVLLTGVRAETEMIKSNQLQRVKEELQENVSLQLMHNLNNSKKIKTLSAMLQNIATQLCQELSKKEPGHKCKPCPKASDWYKDSCYSRFQKYATWQESVEFCSARNASLLKVKNKDELEFIKSKELYNYWLALPPSKMYRSYELLSEKMFLSEGFKRSTYDITKMSCGFIRGEYVYYTNCDEEKYTMCEETASKVQVESVLSDLPEGSILHHHHHH
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.417 mg/mL
Gene Name Clec12a C-type lectin domain family 12, member A [ Rattus norvegicus (Norway rat) ]
Official Symbol CLEC12A
Synonyms CLL1; MICL; CD371; CLL-1; DCAL-2
Gene ID 680338
mRNA Refseq NM_001134716
Protein Refseq NP_001128188
UniProt ID B4F798

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLEC12A Products

Required fields are marked with *

My Review for All CLEC12A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon