Recombinant Full Length Human FCER1A Protein, GST-tagged
Cat.No. : | FCER1A-6928HF |
Product Overview : | Recombinant Human full-length FCER1A (1 a.a. - 257 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 257 amino acids |
Description : | The immunoglobulin epsilon receptor (IgE receptor) is the initiator of the allergic response. When two or more high-affinity IgE receptors are brought together by allergen-bound IgE molecules, mediators such as histamine that are responsible for allergy symptoms are released. This receptor is comprised of an alpha subunit, a beta subunit, and two gamma subunits. The protein encoded by this gene represents the alpha subunit. |
Molecular Mass : | 54.01 kDa |
AA Sequence : | MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETN SSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGE ALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQFFIPLLVVILFAVDTGLFIS TQQQVTFLLKIKRTRKGFRLLNPHPKPNPKNN |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FCER1A Fc epsilon receptor Ia [ Homo sapiens (human) ] |
Official Symbol | FCER1A |
Synonyms | FCER1A; FCE1A; FcERI; Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide; high affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; Fc epsilon RI alpha-chain; igE Fc receptor subunit alpha; Fc IgE receptor, alpha polypeptide; high affinity immunoglobulin epsilon receptor alpha-subunit; immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide |
Gene ID | 2205 |
mRNA Refseq | NM_002001 |
Protein Refseq | NP_001992 |
MIM | 147140 |
UniProt ID | P12319 |
◆ Recombinant Proteins | ||
FCER1A-1459C | Active Recombinant Cynomolgus FCER1A protein, Fc-tagged | +Inquiry |
FCER1A-204H | Recombinant Human FCER1A, His-tagged | +Inquiry |
FCER1A-2099H | Recombinant Human FCER1A Protein (26-205 aa), His-tagged | +Inquiry |
Fcer1a-8688M | Recombinant Mouse Fcer1a protein(Met1-Gln204), hFc-tagged | +Inquiry |
FCER1A-1961R | Recombinant Rat FCER1A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCER1A-1389MCL | Recombinant Mouse FCER1A cell lysate | +Inquiry |
FCER1A-1394HCL | Recombinant Human FCER1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCER1A Products
Required fields are marked with *
My Review for All FCER1A Products
Required fields are marked with *