Recombinant Rat Fc epsilon receptor Ia Protein, His tagged

Cat.No. : FCER1A-2304R
Product Overview : Recombinant Rat FCER1A Protein with His tag was expressed in HEK293F.
Availability July 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Tag : His
Protein Length : 24-200 aa
Description : Predicted to enable IgE binding activity and high-affinity IgE receptor activity. Predicted to be involved in several processes, including eosinophil degranulation; type 2 immune response; and type I hypersensitivity. Predicted to act upstream of or within several processes, including leukotriene biosynthetic process; positive regulation of immune effector process; and positive regulation of macromolecule metabolic process. Predicted to be located in cell surface and plasma membrane. Predicted to be active in external side of plasma membrane. Orthologous to human FCER1A (Fc epsilon receptor Ia).
Tag : C-His
Molecular Mass : 23 kDa
AA Sequence : MDTGGSARLCLALVLISLGVMLTATQKSVVSLDPPWIRILTGDKVTLICNGNNSSQMNSTKWIHNDSISNVKSSHWVIVSATIQDSGKYICQKQGFYKSKPVYLNVMQEWLLLQSSADVVLDNGSFDIRCRSWKKWKVHKVIYYKDDIAFKYSYDSNNISIRKATFNDSGSYHCTGYLNKVECKSDKFSIAVVKDYTIEYHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 80% by SDS-PAGE
Storage : Store it under sterile conditions at -80 centigrade. Avoid repeated freeze-thaw cycles.
Storage Buffer : Liquid in 25 mM Tris-Hcl, pH7.4, 150 mM NaCl, 0.05% DDM
Concentration : 0.5 mg/mL
Gene Name Fcer1a Fc epsilon receptor Ia [ Rattus norvegicus (Norway rat) ]
Official Symbol FCER1A
Synonyms FCER1A; Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide; high affinity immunoglobulin epsilon receptor subunit alpha; fcERI; alpha polypeptide; fc-epsilon RI-alpha; igE Fc receptor subunit alpha; Fc receptor, IgE, high affinity I, alpha polypeptide; Iger01; RATIGER01
Gene ID 25047
mRNA Refseq NM_012724
Protein Refseq NP_036856
UniProt ID P12371

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCER1A Products

Required fields are marked with *

My Review for All FCER1A Products

Required fields are marked with *

0
cart-icon