| Species : |
Rat |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
180 |
| Description : |
Fibroblast growth factor 21 (FGF-21) encoded by the FGF-21 gene belongs to the large FGF family and it is specifically induced by HMGCS2 activity. In mice, brown adipose tissue becomes a source of systemic FGF-21 after cold exposure. FGF-21 stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression) and the activity depends on the presence of KLB. Recombinant rat FGF-21 contains 180 amino acids residues and show limited binding to heparin. In addition, rat FGF-21 respectively shows 81 % and 92 % a.a. identity to human and murine FGF-21, and it show activity on murine and human cells. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, 500 mM NaCl, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml, corresponding to a specific activity of > 2.0 × 10³ IU/mg in the presence of 5 µg/ml of rMuKlotho-β and 10 μg/ml of heparin. |
| Molecular Mass : |
Approximately 19.7 kDa, a single non-glycosylated polypeptide chain containing 180 amino acids. |
| AA Sequence : |
AYPISDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGTAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGTLYGSPHFDPEACSFRELLLKDGYNVYQSEAHGLPLRLPQKDSQDPATRGPVRFLPMPGLPHEPQEQPGVLPPEPPDVGSSDPLSMVEPLQGRSPSYAS |
| Endotoxin : |
Less than 1 EU/µg of rRtFGF-21 as determined by LAL method. |
| Purity : |
>95% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |