Recombinant Rat IGF1 Protein
Cat.No. : | IGF1-121R |
Product Overview : | Recombinant Rat IGF1 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Description : | Insulin-like growth factor I (IGF-I) is a growth factor that is produced by the liver. IGF-1 production is stimulated by growth hormone (GH). IGF-I binds the insulin-like growth factor 1 receptor (IGF1R) and the insulin receptor to stimulate systemic body growth. IGF-I is one of the most potent activators of the AKT signaling pathway, which stimulates cell proliferation and inhibits programmed cell death. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 7.7 kDa (70 aa) |
AA Sequence : | GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Igf1 insulin-like growth factor 1 [ Rattus norvegicus (Norway rat) ] |
Official Symbol | IGF1 |
Synonyms | IGF1; insulin-like growth factor 1; insulin-like growth factor I; IGF-I; somatomedin; |
Gene ID | 24482 |
mRNA Refseq | NM_001082477 |
Protein Refseq | NP_001075946 |
UniProt ID | P08025 |
◆ Recombinant Proteins | ||
IGF1-61H | Recombinant Human IGF1 | +Inquiry |
IGF1-126H | Recombinant Active Human IGF1 Protein, Fc-His-tagged(C-ter) | +Inquiry |
IGF1-658H | Active Recombinant Human Insulin-like Growth Factor 1 | +Inquiry |
IGF1-325H | Active Recombinant Human Des(1-3)Insulin-like Growth Factor 1 | +Inquiry |
IGF1-558H | Recombinant Human IGF1 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF1-5268HCL | Recombinant Human IGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IGF1 Products
Required fields are marked with *
My Review for All IGF1 Products
Required fields are marked with *
0
Inquiry Basket