| Species : |
Rat |
| Source : |
E.coli |
| Description : |
Insulin-like growth factor I (IGF-I) is a growth factor that is produced by the liver. IGF-1 production is stimulated by growth hormone (GH). IGF-I binds the insulin-like growth factor 1 receptor (IGF1R) and the insulin receptor to stimulate systemic body growth. IGF-I is one of the most potent activators of the AKT signaling pathway, which stimulates cell proliferation and inhibits programmed cell death. |
| Bio-activity : |
No biological activity data is available at this time. |
| Molecular Mass : |
Monomer, 7.7 kDa (70 aa) |
| AA Sequence : |
GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA |
| Endotoxin : |
≤1 EUs/μg, Kinetic LAL |
| Purity : |
≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : |
12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : |
Storage Prior to Reconstitution: -20 centigrade |
| Storage Buffer : |
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
| Reconstitution : |
Sterile water at 0.1 mg/mL |
| Shipping : |
Room temperature |
| Instructions : |
Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
