Recombinant Rat S100a9 Protein, His-SUMO-tagged
Cat.No. : | S100a9-1362H |
Product Overview : | Recombinant Rat S100a9 Protein (2-113aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-113 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 29.0 kDa |
AA Sequence : | AAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTNQ DNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHSHGKGCGK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | S100a9 S100 calcium binding protein A9 [ Rattus norvegicus (Norway rat) ] |
Official Symbol | S100a9 |
Synonyms | Mrp14 |
Gene ID | 94195 |
mRNA Refseq | NM_053587.1 |
Protein Refseq | NP_446039.1 |
UniProt ID | P50116 |
◆ Recombinant Proteins | ||
S100A9-3590M | Recombinant Full Length Mouse S100A9, His-tagged | +Inquiry |
S100A9-433H | Recombinant Human S100 Calcium Binding Protein A9, Cys3Ser Mutated | +Inquiry |
S100A9-0051c | Recombinant Human S100A9 Protein | +Inquiry |
S100A9-4875R | Recombinant Rat S100A9 Protein, His (Fc)-Avi-tagged | +Inquiry |
S100A9-3879H | Recombinant Full Length Human S100A9, None tagged | +Inquiry |
◆ Native Proteins | ||
S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A9-684HCL | Recombinant Human S100A9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100a9 Products
Required fields are marked with *
My Review for All S100a9 Products
Required fields are marked with *