Recombinant Rat S100a9 Protein, His-SUMO-tagged

Cat.No. : S100a9-1362H
Product Overview : Recombinant Rat S100a9 Protein (2-113aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His&SUMO
Protein Length : 2-113 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 29.0 kDa
AA Sequence : AAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTNQ
DNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHSHGKGCGK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name S100a9 S100 calcium binding protein A9 [ Rattus norvegicus (Norway rat) ]
Official Symbol S100a9
Synonyms Mrp14
Gene ID 94195
mRNA Refseq NM_053587.1
Protein Refseq NP_446039.1
UniProt ID P50116

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100a9 Products

Required fields are marked with *

My Review for All S100a9 Products

Required fields are marked with *

0
cart-icon