Recombinant Rat S100a9 Protein, His-SUMO-tagged
| Cat.No. : | S100a9-1362H | 
| Product Overview : | Recombinant Rat S100a9 Protein (2-113aa) was expressed in E. coli with N-terminal His-SUMO tag. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat | 
| Source : | E.coli | 
| Tag : | His&SUMO | 
| Protein Length : | 2-113 a.a. | 
| Form : | Tris-based buffer, 50% glycerol. | 
| Molecular Mass : | 29.0 kDa | 
| AA Sequence : | AAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTNQ DNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHSHGKGCGK | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. | 
| Gene Name | S100a9 S100 calcium binding protein A9 [ Rattus norvegicus (Norway rat) ] | 
| Official Symbol | S100a9 | 
| Synonyms | Mrp14 | 
| Gene ID | 94195 | 
| mRNA Refseq | NM_053587.1 | 
| Protein Refseq | NP_446039.1 | 
| UniProt ID | P50116 | 
| ◆ Recombinant Proteins | ||
| S100A9-3590M | Recombinant Full Length Mouse S100A9, His-tagged | +Inquiry | 
| S100A9-433H | Recombinant Human S100 Calcium Binding Protein A9, Cys3Ser Mutated | +Inquiry | 
| S100A9-0051c | Recombinant Human S100A9 Protein | +Inquiry | 
| S100A9-4875R | Recombinant Rat S100A9 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| S100A9-3879H | Recombinant Full Length Human S100A9, None tagged | +Inquiry | 
| ◆ Native Proteins | ||
| S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| S100A9-684HCL | Recombinant Human S100A9 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100a9 Products
Required fields are marked with *
My Review for All S100a9 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            