Recombinant Rat S100a9 Protein, His-SUMO-tagged

• Cat.No.: S100a9-1362H
• Product Overview: Recombinant Rat S100a9 Protein (2-113aa) was expressed in E. coli with N-terminal His-SUMO tag.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 2-113 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 29.0 kDa
• AA Sequence: AAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTNQ
  DNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHSHGKGCGK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: S100a9 S100 calcium binding protein A9 [ Rattus norvegicus (Norway rat) ]
• Official Symbol: S100a9
• Synonyms: Mrp14
• Gene ID: 94195
• mRNA Refseq: NM_053587.1
• Protein Refseq: NP_446039.1
• UniProt ID: P50116