"S100a9" Related Products

Expand
Expand
Expand

Recombinant Rat S100a9 Protein, His-SUMO-tagged

Cat.No. : S100a9-1362H
Product Overview : Recombinant Rat S100a9 Protein (2-113aa) was expressed in E. coli with N-terminal His-SUMO tag.
Source : E. coli
Species : Rat
Tag : His-SUMO
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 29.0 kDa
AA Sequence : AAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTNQ
DNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHSHGKGCGK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Figure :

Gene Name : S100a9 S100 calcium binding protein A9 [ Rattus norvegicus (Norway rat) ]
Official Symbol : S100a9
Synonyms : Mrp14
Gene ID : 94195
mRNA Refseq : NM_053587.1
Protein Refseq : NP_446039.1
UniProt ID : P50116

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.