Recombinant Rat Sod1 protein, His-SUMO-tagged
Cat.No. : | Sod1-4632R |
Product Overview : | Recombinant Rat Sod1 protein(P07632)(2-154aa), fused with N-terminal His tag and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-154aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | AMKAVCVLKGDGPVQGVIHFEQKASGEPVVVSGQITGLTEGEHGFHVHQYGDNTQGCTTAGPHFNPHSKKHGGPADEERHVGDLGNVAAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ |
Gene Name | Sod1 superoxide dismutase 1, soluble [ Rattus norvegicus ] |
Official Symbol | Sod1 |
Synonyms | SOD1; superoxide dismutase 1, soluble; superoxide dismutase [Cu-Zn]; CuZnSOD; |
Gene ID | 24786 |
mRNA Refseq | NM_017050 |
Protein Refseq | NP_058746 |
◆ Recombinant Proteins | ||
SOD1-5666R | Recombinant Rat SOD1 Protein | +Inquiry |
SOD1-1158H | Recombinant Human SOD1 Protein, MYC/DDK-tagged | +Inquiry |
sod1-1373Z | Recombinant Zebrafish sod1 Protein, His-SUMO/MYC-tagged | +Inquiry |
SOD1-8884Z | Recombinant Zebrafish SOD1 | +Inquiry |
SOD1-2024S | Recombinant Sheep SOD1 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
CED026 | Active Bovine Superoxide Dismutase (SOD), High Purity >95% | +Inquiry |
SOD1-101B | Active Native Bovine SOD | +Inquiry |
SOD1-102B | Active Native Bovine SOD, modified | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOD1-1576HCL | Recombinant Human SOD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sod1 Products
Required fields are marked with *
My Review for All Sod1 Products
Required fields are marked with *