Recombinant Rat Sort1 protein, His-tagged
| Cat.No. : | Sort1-3517R |
| Product Overview : | Recombinant Rat Sort1 protein(O54861)(610-754aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 610-754aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 20.5 kDa |
| AA Sequence : | CEENDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSICPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDRCQGGMNPAREVKDLKKKCTSNFLNPKKQNSKSSS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Sort1 sortilin 1 [ Rattus norvegicus ] |
| Official Symbol | Sort1 |
| Synonyms | SORT1; sortilin 1; sortilin; NTR3; gp110; glycoprotein 110; neurotensin receptor 3; Nt3; Nts3; |
| Gene ID | 83576 |
| mRNA Refseq | NM_031767 |
| Protein Refseq | NP_113955 |
| ◆ Recombinant Proteins | ||
| SORT1-4105H | Recombinant Human SORT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SORT1-6212H | Recombinant Human SORT1 Protein (Trp50-Asp320), N-GST tagged | +Inquiry |
| SORT1-5331R | Recombinant Rat SORT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SORT1-0721H | Recombinant Human SORT1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| SORT1-2879H | Recombinant Human SORT1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SORT1-493HKCL | Human SORT1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sort1 Products
Required fields are marked with *
My Review for All Sort1 Products
Required fields are marked with *
