Recombinant Rat Sort1 protein, His-tagged
Cat.No. : | Sort1-3517R |
Product Overview : | Recombinant Rat Sort1 protein(O54861)(610-754aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 610-754aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.5 kDa |
AA Sequence : | CEENDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSICPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDRCQGGMNPAREVKDLKKKCTSNFLNPKKQNSKSSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Sort1 sortilin 1 [ Rattus norvegicus ] |
Official Symbol | Sort1 |
Synonyms | SORT1; sortilin 1; sortilin; NTR3; gp110; glycoprotein 110; neurotensin receptor 3; Nt3; Nts3; |
Gene ID | 83576 |
mRNA Refseq | NM_031767 |
Protein Refseq | NP_113955 |
◆ Recombinant Proteins | ||
Sort1-3517R | Recombinant Rat Sort1 protein, His-tagged | +Inquiry |
SORT1-0721H | Recombinant Human SORT1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
SORT1-5672R | Recombinant Rat SORT1 Protein | +Inquiry |
SORT1-0722H | Recombinant Human SORT1 protein, His-tagged | +Inquiry |
SORT1-5331R | Recombinant Rat SORT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sort1 Products
Required fields are marked with *
My Review for All Sort1 Products
Required fields are marked with *
0
Inquiry Basket