Recombinant Rhesus Monkey CD70 Protein, his-tagged

• Cat.No.: CD70-01H
• Product Overview: Recombinant Rhesus Monkey CD70 Protein with N-terminal his6 fusion tag was expressed in HEK293.

Specification

• Species: Rhesus macaque
• Source: HEK293
• Tag: His
• Protein Length: 157
• Description: Cytokine which is the ligand for CD27. The CD70-CD27 pathway plays an important role in the generation and maintenance of T cell immunity, in particular during antiviral responses. Upon CD27 binding, induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
• Form: Buffered aqueous solution
• Molecular Mass: 17.5 kDa
• AA Sequence: HHHHHHAQQQLPLESLGWDIAELQLNHTGPQQDPRLYWQGGPALGRSFLRGPELDKGQLRIRRDGIYMVHIQVTLAICSSTSTSRHHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
• Endotoxin: ＜1EU/ug by LAL
• Purity: ＞95% by SDS-PAGE
• Applications: ELISA, WB, Immunogen
• Storage: Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.7 mg/ml
• Storage Buffer: Solution in PBS, pH 7.4

Gene Information

• Gene Name: CD70
• Official Symbol: CD70
• Synonyms: CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A
• Gene ID: 970
• mRNA Refseq: U78091.1
• Protein Refseq: XP_001088935.3