Recombinant Rhesus Monkey CD70 Protein, his-tagged

Cat.No. : CD70-01H
Product Overview : Recombinant Rhesus Monkey CD70 Protein with N-terminal his6 fusion tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : HEK293
Tag : His
Protein Length : 157
Description : Cytokine which is the ligand for CD27. The CD70-CD27 pathway plays an important role in the generation and maintenance of T cell immunity, in particular during antiviral responses. Upon CD27 binding, induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
Form : Buffered aqueous solution
Molecular Mass : 17.5 kDa
AA Sequence : HHHHHHAQQQLPLESLGWDIAELQLNHTGPQQDPRLYWQGGPALGRSFLRGPELDKGQLRIRRDGIYMVHIQVTLAICSSTSTSRHHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Endotoxin : <1EU/ug by LAL
Purity : >95% by SDS-PAGE
Applications : ELISA, WB, Immunogen
Storage : Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.7 mg/ml
Storage Buffer : Solution in PBS, pH 7.4
Gene Name CD70
Official Symbol CD70
Synonyms CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A
Gene ID 970
mRNA Refseq U78091.1
Protein Refseq XP_001088935.3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD70 Products

Required fields are marked with *

My Review for All CD70 Products

Required fields are marked with *

0
cart-icon
0
compare icon