Recombinant Rhesus SAA1 protein

Cat.No. : SAA1-5197R
Product Overview : Recombinant Rhesus SAA1 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : E.coli
Tag : Non
Protein Length : 104
Description : Serum Amyloid A protein-1 belongs to the SAA family of apolipoproteins that circulates in association with high-density lipoproteins (HDL). It is a multifunctional protein produced by hepatocytes in response to pro-inflammatory cytokines. SAA1 is a ligand for CD36/SR-B3, SR-B1, FPRL1, TLR2, and RAGE on monocytes/macrophages, inducing chemotaxis and generation of cytokines and tissue factor. It also can bind the surface of invading gram-negative bacteria, acting as an opsonin to aid clearance by macrophages. Additionally, SAA1 binds platelets, probably by engaging fibrinogen on the platelet surface.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 10-100 ng/ml.
Molecular Mass : Approximately 11.7 kDa, a single non-glycosylated polypeptide chain containing 104 amino acids.
AA Sequence : RSWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPGGVWAAEVISDARENIQKLLGRGAEDTLADQAANEWGRSGKDPNHFRPAGLPEKY
Endotoxin : Less than 1 EU/μg of rRhSAA1 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name SAA1
Official Symbol SAA1
Synonyms Amyloid fibril protein AA
Gene ID 694827
mRNA Refseq XM_015114692.2
Protein Refseq XP_014970178.2
UniProt ID F6V9N7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SAA1 Products

Required fields are marked with *

My Review for All SAA1 Products

Required fields are marked with *

0
cart-icon