| Species : |
Rhesus macaque |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
104 |
| Description : |
Serum Amyloid A protein-1 belongs to the SAA family of apolipoproteins that circulates in association with high-density lipoproteins (HDL). It is a multifunctional protein produced by hepatocytes in response to pro-inflammatory cytokines. SAA1 is a ligand for CD36/SR-B3, SR-B1, FPRL1, TLR2, and RAGE on monocytes/macrophages, inducing chemotaxis and generation of cytokines and tissue factor. It also can bind the surface of invading gram-negative bacteria, acting as an opsonin to aid clearance by macrophages. Additionally, SAA1 binds platelets, probably by engaging fibrinogen on the platelet surface. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 10-100 ng/ml. |
| Molecular Mass : |
Approximately 11.7 kDa, a single non-glycosylated polypeptide chain containing 104 amino acids. |
| AA Sequence : |
RSWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPGGVWAAEVISDARENIQKLLGRGAEDTLADQAANEWGRSGKDPNHFRPAGLPEKY |
| Endotoxin : |
Less than 1 EU/μg of rRhSAA1 as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |