Recombinant Rhesus SAA1 protein
Cat.No. : | SAA1-5197R |
Product Overview : | Recombinant Rhesus SAA1 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Tag : | Non |
Protein Length : | 104 |
Description : | Serum Amyloid A protein-1 belongs to the SAA family of apolipoproteins that circulates in association with high-density lipoproteins (HDL). It is a multifunctional protein produced by hepatocytes in response to pro-inflammatory cytokines. SAA1 is a ligand for CD36/SR-B3, SR-B1, FPRL1, TLR2, and RAGE on monocytes/macrophages, inducing chemotaxis and generation of cytokines and tissue factor. It also can bind the surface of invading gram-negative bacteria, acting as an opsonin to aid clearance by macrophages. Additionally, SAA1 binds platelets, probably by engaging fibrinogen on the platelet surface. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 10-100 ng/ml. |
Molecular Mass : | Approximately 11.7 kDa, a single non-glycosylated polypeptide chain containing 104 amino acids. |
AA Sequence : | RSWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPGGVWAAEVISDARENIQKLLGRGAEDTLADQAANEWGRSGKDPNHFRPAGLPEKY |
Endotoxin : | Less than 1 EU/μg of rRhSAA1 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | SAA1 |
Official Symbol | SAA1 |
Synonyms | Amyloid fibril protein AA |
Gene ID | 694827 |
mRNA Refseq | XM_015114692.2 |
Protein Refseq | XP_014970178.2 |
UniProt ID | F6V9N7 |
◆ Recombinant Proteins | ||
SAA1-1947H | Recombinant Human SAA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SAA1-4539S | Recombinant Sheep SAA1 protein, DEEP1-tagged | +Inquiry |
SAA1-2345H | Recombinant Horse SAA1 Protein (1-110 aa), His-tagged | +Inquiry |
Apo-SAA-3552H | Recombinant Human Apo-SAA | +Inquiry |
SAA1-3467B | Recombinant Bovine SAA1 protein, His-SUMO & Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAA1-2080HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
SAA1-2081HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAA1 Products
Required fields are marked with *
My Review for All SAA1 Products
Required fields are marked with *
0
Inquiry Basket