Recombinant Sheep SAA1 protein, DEEP1-tagged
Cat.No. : | SAA1-4539S |
Product Overview : | Recombinant Sheep SAA1 protein(P42819)(1-112aa), fused to C-terminal DEEP1 tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | Yeast |
Protein Length : | 1-112aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.3 kDa |
AA Sequence : | QWLSFLGEAYEGAKDMWRAYSDMREANFKGADKYFHARGNYDAAQRGPGGVWAAEVISNGREALQGITDPLFKGMTRDQVREDTKADQFANEWGRSGKDPNHFRPPGLPDKY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
SAA1-3692H | Recombinant Human SAA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SAA1-1012H | Recombinant Human SAA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SAA1-6233H | Recombinant Human SAA1 Protein, His-tagged | +Inquiry |
SAA1-2375R | Recombinant Rabbit SAA1 Protein (20-122 aa), His-SUMO-Myc-tagged | +Inquiry |
SAA1-04H | Recombinant Feline SAA1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAA1-2081HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
SAA1-2080HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAA1 Products
Required fields are marked with *
My Review for All SAA1 Products
Required fields are marked with *