Recombinant Sheep SAA1 protein, DEEP1-tagged
| Cat.No. : | SAA1-4539S |
| Product Overview : | Recombinant Sheep SAA1 protein(P42819)(1-112aa), fused to C-terminal DEEP1 tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Sheep |
| Source : | Yeast |
| Protein Length : | 1-112aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 25.3 kDa |
| AA Sequence : | QWLSFLGEAYEGAKDMWRAYSDMREANFKGADKYFHARGNYDAAQRGPGGVWAAEVISNGREALQGITDPLFKGMTRDQVREDTKADQFANEWGRSGKDPNHFRPPGLPDKY |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| ◆ Recombinant Proteins | ||
| SAA1-31162TH | Recombinant Human SAA1 | +Inquiry |
| SAA1-31166TH | Recombinant Human SAA1, His-tagged | +Inquiry |
| Apo-SAA-3552H | Recombinant Human Apo-SAA | +Inquiry |
| Saa1-3468M | Recombinant Mouse Saa1 protein, His-SUMO-tagged | +Inquiry |
| SAA1-3467B | Recombinant Bovine SAA1 protein, His-SUMO & Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SAA1-2080HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
| SAA1-2081HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAA1 Products
Required fields are marked with *
My Review for All SAA1 Products
Required fields are marked with *
