Recombinant Horse SAA1 Protein (1-110 aa), His-tagged

Cat.No. : SAA1-2345H
Product Overview : Recombinant Horse SAA1 Protein (1-110 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Horse
Source : Yeast
Tag : His
Protein Length : 1-110 aa
Description : Major acute phase reactant. Apolipoprotein of the HDL complex.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 14.3 kDa
AA Sequence : LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name SAA1 serum amyloid A1 [ Equus caballus ]
Official Symbol SAA1
Synonyms SAA1; serum amyloid A1; serum amyloid A protein; SAA;
Gene ID 100034017
mRNA Refseq NM_001163892
Protein Refseq NP_001157364
UniProt ID P19857

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SAA1 Products

Required fields are marked with *

My Review for All SAA1 Products

Required fields are marked with *

0
cart-icon