Recombinant Horse SAA1 Protein (1-110 aa), His-tagged
| Cat.No. : | SAA1-2345H |
| Product Overview : | Recombinant Horse SAA1 Protein (1-110 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Horse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-110 aa |
| Description : | Major acute phase reactant. Apolipoprotein of the HDL complex. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 14.3 kDa |
| AA Sequence : | LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | SAA1 serum amyloid A1 [ Equus caballus ] |
| Official Symbol | SAA1 |
| Synonyms | SAA1; serum amyloid A1; serum amyloid A protein; SAA; |
| Gene ID | 100034017 |
| mRNA Refseq | NM_001163892 |
| Protein Refseq | NP_001157364 |
| UniProt ID | P19857 |
| ◆ Recombinant Proteins | ||
| SAA1-6231H | Recombinant Human SAA1 Protein (Ser20-Tyr122), N-His tagged | +Inquiry |
| SAA1-2497H | Recombinant Human SAA1 protein, GST-tagged | +Inquiry |
| SAA1-1403H | Recombinant Human Serum Amyloid A1 | +Inquiry |
| SAA1-04H | Recombinant Feline SAA1 Protein | +Inquiry |
| SAA1-1363C | Recombinant Cat SAA1 Protein, His-B2M-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SAA1-2080HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
| SAA1-2081HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAA1 Products
Required fields are marked with *
My Review for All SAA1 Products
Required fields are marked with *



