Active Recombinant Human CSF1 Protein

Cat.No. : CSF1-223C
Product Overview : Recombinant Human CSF1 Protein without tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Description : Human Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells. M-CSF interaction with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of of several diseases, including breast and endometrial cancers.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50< 5 ng/mL, measured in a cell proliferation assay using Murine M-NFS-60 cells, corresponding to a specific activity of > 2 × 10^5 units/mg.
Molecular Mass : 32-40 kDa, observed by non-reducing SDS-PAGE.
AA Sequence : EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant human Macrophage-Colony Stimulating Factor (rhM-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhM-CSF should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name CSF1 colony stimulating factor 1 (macrophage) [ Homo sapiens ]
Official Symbol CSF1
Synonyms CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; M CSF; MCSF; MGC31930; lanimostim; CSF-1;
Gene ID 1435
mRNA Refseq NM_000757
Protein Refseq NP_000748
MIM 120420
UniProt ID P09603

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSF1 Products

Required fields are marked with *

My Review for All CSF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon