Active Recombinant Human FGF23 Protein (228 aa)

Cat.No. : FGF23-118F
Product Overview : Recombinant Human FGF23 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 228
Description : Fibroblast growth factor 23 (FGF-23) belongs to the large FGF family which has at least 23 members. All FGF family members are heparin binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. FGFs are expressed during embryonic development and in restricted adult tissues. Four distinct but related classes of FGF receptors, FGF R1, 2, 3, and 4, exist. FGF23 is produced by osteocytes and osteoblasts in response to high circulating phosphate levels, elevated parathyroid hormone, and circulatory volume loading. It functions as an endocrine phosphatonin by suppressing circulating phosphate levels. FGF23 interaction with renal proximal tubular epithelium decreases the renal resorption of phosphate by down regulating phosphate transporters and by suppressing vitamin D production. It also decreases the intestinal absorption of phosphate.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Measured in a cell proliferation assay using NIH/3T3 mouse embryonic fibroblasts. The ED50 for this effect is typically 0.05-0.3 μg/mL in the presence of 5 μg/mL of Recombinant Mouse Klotho and 10 μg/mL of heparin.
Molecular Mass : Approximately 22.5 kDa, a single non-glycosylated polypeptide chain containing 228 amino acids.
AA Sequence : MYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
Endotoxin : Less than 1 EU/mg of rHuFGF-23 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name FGF23 fibroblast growth factor 23 [ Homo sapiens ]
Official Symbol FGF23
Synonyms FGF23; fibroblast growth factor 23; fibroblast growth factor 23; phosphatonin; tumor-derived hypophosphatemia inducing factor
Gene ID 53406
mRNA Refseq NM_020638
Protein Refseq NP_065689
MIM 605380
UniProt ID Q9GZV9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF23 Products

Required fields are marked with *

My Review for All FGF23 Products

Required fields are marked with *

0
cart-icon
0
compare icon