Recombinant Human FGF23 protein
Cat.No. : | FGF23-523H |
Product Overview : | Recombinant Human FGF23 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 227 |
Description : | Human FGF-23 belongs to the FGF-19 subfamily which has three members FGF-19, 21, 23. All FGF family members are heparin binding growth factors with a core 120 amino acid (a.a.) FGF domain that allows for a common tertiary structure. They are classically considered to be paracrine factors and are known for their roles in tissue patterning and organogenesis during embryogenesis. By contrast, the FGF-19 subfamily has recently been shown to function in an endocrine manner. Members of this subfamily have poor ability of binding to heparin binding site which is a crucial factor in ligand-receptor complex formation. β-Klotho has been identified as co-factor required for FGF-19, 21, 23 signaling. It can obviously increase ligand-receptor affinity. FGF-23 is most highly expressed in bone, from which it circulates through the blood to regulate vitamin D and phosphate metabolism in kidney. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml, corresponding to a specific activity of > 2.0 × 10³ IU/mg in the presence of 0.3 μg/ml of rMuKlotho and 10 μg/ml of heparin. |
Molecular Mass : | Approximately 25.3 kDa, a single non-glycosylated polypeptide chain containing 227 amino acids. |
AA Sequence : | YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI |
Endotoxin : | Less than 1 EU/µg of rHuFGF-23 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | FGF23 |
Official Symbol | FGF23 |
Synonyms | FGF23; fibroblast growth factor 23; |
Gene ID | 53406 |
mRNA Refseq | NM_020638.3 |
Protein Refseq | NP_065689.1 |
MIM | 605380 |
UniProt ID | Q9GZV9 |
◆ Recombinant Proteins | ||
Fgf23-7408M | Active Recombinant Mouse Fgf23 Protein | +Inquiry |
Fgf23-2998M | Recombinant Mouse Fgf23 Protein, Myc/DDK-tagged | +Inquiry |
FGF23-4112H | Recombinant Human FGF23 Protein, GST-tagged | +Inquiry |
FGF23-3431H | Recombinant Human FGF23 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FGF23-3589H | Recombinant Human FGF23 Protein (Ser180-Ile251), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF23-6241HCL | Recombinant Human FGF23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF23 Products
Required fields are marked with *
My Review for All FGF23 Products
Required fields are marked with *
0
Inquiry Basket