Recombinant Human FGF23 protein

Cat.No. : FGF23-523H
Product Overview : Recombinant Human FGF23 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 227
Description : Human FGF-23 belongs to the FGF-19 subfamily which has three members FGF-19, 21, 23. All FGF family members are heparin binding growth factors with a core 120 amino acid (a.a.) FGF domain that allows for a common tertiary structure. They are classically considered to be paracrine factors and are known for their roles in tissue patterning and organogenesis during embryogenesis. By contrast, the FGF-19 subfamily has recently been shown to function in an endocrine manner. Members of this subfamily have poor ability of binding to heparin binding site which is a crucial factor in ligand-receptor complex formation. β-Klotho has been identified as co-factor required for FGF-19, 21, 23 signaling. It can obviously increase ligand-receptor affinity. FGF-23 is most highly expressed in bone, from which it circulates through the blood to regulate vitamin D and phosphate metabolism in kidney.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml, corresponding to a specific activity of > 2.0 × 10³ IU/mg in the presence of 0.3 μg/ml of rMuKlotho and 10 μg/ml of heparin.
Molecular Mass : Approximately 25.3 kDa, a single non-glycosylated polypeptide chain containing 227 amino acids.
AA Sequence : YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
Endotoxin : Less than 1 EU/µg of rHuFGF-23 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name FGF23
Official Symbol FGF23
Synonyms FGF23; fibroblast growth factor 23;
Gene ID 53406
mRNA Refseq NM_020638.3
Protein Refseq NP_065689.1
MIM 605380
UniProt ID Q9GZV9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF23 Products

Required fields are marked with *

My Review for All FGF23 Products

Required fields are marked with *

0
cart-icon