| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
Non |
| Description : |
Lymphotoxin-alpha (LT-a) is a pro-inflammatory cytokine expressed in activated T cells,B cells, natural killer cells, as well as some non-hematopoietic cells. Activation signals include bacterial products, virus infection, T cell receptor activation, crosslinking of surface immunoglobulin (Ig) on B-lymphocytes, and exposure to UV light in epithelial cells. LT-a regulates a variety of biological processes including cell proliferation, apoptosis, coagulation and lipid metabolism. |
| Amino Acid Sequence : |
LPGVGLTPSAAQTARQHPKMHLAHSNLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL. |
| Molecular Mass : |
Lymphotoxin-alpha migrates as a broad band between 20 and 25 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified Lymphotoxin-alpha that has a predicted molecular mass of 18.7kDa. |
| pI : |
Lymphotoxin-alpha separates into a number of isoforms with a pI between 6 and 9 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified Lymphotoxin-alpha that has a predicted pI of 8.94. |
| % Carbohydrate : |
Purified Lymphotoxin-alpha consists of 0-25% carbohydrate. |
| Glycosylation : |
Lymphotoxin-alpha contains N-linked and possibly O-linked oligosaccharides. |
| Purity : |
>95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue. |
| Formulation : |
When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
| Reconstitution : |
It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
| Storage : |
Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended. |
| Activity : |
The ED50 of Lymphotoxin-alpha is typically 0.05 - 0.07 ng/ml as measured in acytotoxicity assay using the murine WEHI 164 cell line in the presence of actinomycin D. |
