Active Recombinant Human Lymphotoxin Alpha (TNF Superfamily, Member 1)

Cat.No. : LTA-165H
Product Overview : Recombinant Human lymphotoxin Alpha (TNF Superfamily, Member 1) encoding the human Lymphotoxin alpha (LT-a) protein sequence (containing the signal peptide sequence, and the mature human Lymphotoxin alpha sequence) was expressed in modifiedhuman 293 cells.
Availability June 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Non
Description : Lymphotoxin-alpha (LT-a) is a pro-inflammatory cytokine expressed in activated T cells,B cells, natural killer cells, as well as some non-hematopoietic cells. Activation signals include bacterial products, virus infection, T cell receptor activation, crosslinking of surface immunoglobulin (Ig) on B-lymphocytes, and exposure to UV light in epithelial cells. LT-a regulates a variety of biological processes including cell proliferation, apoptosis, coagulation and lipid metabolism.
Amino Acid Sequence : LPGVGLTPSAAQTARQHPKMHLAHSNLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL.
Molecular Mass : Lymphotoxin-alpha migrates as a broad band between 20 and 25 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified Lymphotoxin-alpha that has a predicted molecular mass of 18.7kDa.
pI : Lymphotoxin-alpha separates into a number of isoforms with a pI between 6 and 9 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified Lymphotoxin-alpha that has a predicted pI of 8.94.
% Carbohydrate : Purified Lymphotoxin-alpha consists of 0-25% carbohydrate.
Glycosylation : Lymphotoxin-alpha contains N-linked and possibly O-linked oligosaccharides.
Purity : >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
Formulation : When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution : It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage : Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Activity : The ED50 of Lymphotoxin-alpha is typically 0.05 - 0.07 ng/ml as measured in acytotoxicity assay using the murine WEHI 164 cell line in the presence of actinomycin D.
Gene Name LTA lymphotoxin alpha (TNF superfamily, member 1) [ Homo sapiens ]
Synonyms LTA; lymphotoxin alpha (TNF superfamily, member 1); LT; TNFB; TNFSF1; lymphotoxin alpha; OTTHUMP00000165897; tumor necrosis factor beta; Tumor necrosis factor ligand superfamily member 1; TNF-beta; LT-alpha
Gene ID 4049
mRNA Refseq NM_000595
Protein Refseq NP_000586
UniProt ID P01374
Chromosome Location 6p21.3
MIM 153440
Pathway Antigen processing and presentation; Cytokine-cytokine receptor interaction; Type I diabetes mellitus
Function cytokine activity; tumor necrosis factor receptor binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LTA Products

Required fields are marked with *

My Review for All LTA Products

Required fields are marked with *

0
cart-icon