Active Recombinant Human TDGF1, Fc-tagged
Cat.No. : | TDGF1-27821TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 31-169 of Human Cripto1 fused to the Fc region of human IgG1 (aa 90-330). The chimeric protein was expressed in modified human 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Modified human 293 cells |
Tag : | Fc |
Protein Length : | 31-169 a.a. |
Description : | This gene encodes an epidermal growth factor-related protein that contains a cripto, FRL-1, and cryptic domain. The encoded protein is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. Pseudogenes of this gene are found on chromosomes 2, 3, 6, 8, 19 and X. Alternate splicing results in multiple transcript variants. |
Conjugation : | Fc |
Tissue specificity : | Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts. |
Biological activity : | 200 ng/ml of this Chimera induces ERK1 and ERK2 phosphorylation in human umbilical vein endothelial (HUVEC) cells. |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not rec |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical sequence:LGHQEFARPSRGYLAFRDDSIWPQEEPAI RPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCAC PPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWH GQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK |
Sequence Similarities : | Contains 1 EGF-like domain. |
Gene Name | TDGF1 teratocarcinoma-derived growth factor 1 [ Homo sapiens ] |
Official Symbol | TDGF1 |
Synonyms | TDGF1; teratocarcinoma-derived growth factor 1; CR; CRIPTO; Cripto 1; |
Gene ID | 6997 |
mRNA Refseq | NM_001174136 |
Protein Refseq | NP_001167607 |
Uniprot ID | P13385 |
Chromosome Location | 3p21.31 |
Pathway | Developmental Biology, organism-specific biosystem; Glypican 1 network, organism-specific biosystem; Regulation of Signaling by NODAL, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; |
Function | growth factor activity; protein binding; receptor binding; |
◆ Recombinant Proteins | ||
TDGF1-6407H | Recombinant Human TDGF1 Protein (Leu31-Ser169), C-Fc tagged | +Inquiry |
TDGF1-166R | Recombinant Rat Tdgf1, His tagged | +Inquiry |
TDGF1-572H | Active Recombinant Human TDGF1 protein, His-tagged | +Inquiry |
TDGF1-3170H | Recombinant Human TDGF1, GST-tagged | +Inquiry |
TDGF1-27821TH | Active Recombinant Human TDGF1, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TDGF1-832RCL | Recombinant Rat TDGF1 cell lysate | +Inquiry |
TDGF1-2432HCL | Recombinant Human TDGF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TDGF1 Products
Required fields are marked with *
My Review for All TDGF1 Products
Required fields are marked with *
0
Inquiry Basket