Active Recombinant Mouse Ccl20 Protein

Cat.No. : Ccl20-2032M
Product Overview : Purified recombinant protein of Mouse chemokine (C-C motif) ligand 20 (Ccl20), transcript variant 2 without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Acts as a ligand for C-C chemokine receptor CCR6. Signals through binding and activation of CCR6 and induces a strong chemotactic response and mobilization of intracellular calcium ions. The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and autoimmune diseases. CCL20 acts as a chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Involved in the recruitment of both the proinflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation. Required for optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells. Positively regulates sperm motility and chemotaxis via its binding to CCR6 which triggers Ca2+ mobilization in the sperm which is important for its motility. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells.
Bio-activity : Determined by its ability to chemoattract murine CCR6 transfected HEK/293 cells using a concentration range of 0.1-10.0 ng/mL.
Molecular Mass : 7.9 kDa
AA Sequence : ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM
Endotoxin : < 0.1 ng/μg of protein (< 1 EU/μg)
Purity : > 95% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2
Gene Name Ccl20 chemokine (C-C motif) ligand 20 [ Mus musculus (house mouse) ]
Official Symbol Ccl20
Synonyms Ccl20; chemokine (C-C motif) ligand 20; MI; MIP; ST3; CKb4; LARC; ST38; Scya; MIP-3; MIP3A; MIP-3A; Scya20; exodus; MIP-3[a]; exodus-1; C-C motif chemokine 20; CC chemokine LARC; CC chemokine ST38; MIP-3-alpha; beta-chemokine exodus-1; liver and activation-regulated chemokine; macrophage inflammatory protein 3 alpha; small inducible cytokine subfamily A20; small-inducible cytokine A20
Gene ID 20297
mRNA Refseq NM_001159738
Protein Refseq NP_001153210
UniProt ID O89093

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl20 Products

Required fields are marked with *

My Review for All Ccl20 Products

Required fields are marked with *

0
cart-icon
0
compare icon