Active Recombinant Mouse Il25 Protein, His-Tagged
Cat.No. : | Il25-01M |
Product Overview : | Recombinant mouse Il25 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Interleukin-25 (IL-25) is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cytokine receptor IL17BR. IL-25 is a member of the IL-17 family of cytokines. However, unlike the other members of this family, IL-25 promotes T helper (Th) 2 responses. IL-25 also regulates the development of autoimmune inflammation mediated by IL-17–producing T cells. IL-25 and IL-17, being members of the same cytokine family, play opposing roles in the pathogenesis of organ-specific autoimmunity. |
Form : | Lyophilized powder |
AA Sequence : | MVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHC VSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measured by its ability to induce CXCL1 secretion in HT‑29 cells. The ED50 for this effect is <1 ng/mL. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il25 interleukin 25 [ Mus musculus (house mouse) ] |
Official Symbol | Il25 |
Synonyms | Il17e; IL-17e |
Gene ID | 140806 |
mRNA Refseq | NM_080729.3 |
Protein Refseq | NP_542767.1 |
UniProt ID | Q8VHH8 |
◆ Recombinant Proteins | ||
IL25-276H | Active Recombinant Human IL25 Protein (Tyr33-Gly177), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL25-149M | Recombinant Mouse IL25, His tagged | +Inquiry |
IL25-148H | Active Recombinant Human IL25 protein, hFc-tagged | +Inquiry |
IL25-3616H | Recombinant Human IL25 Protein (Met28-Gly177), His tagged | +Inquiry |
Il25-90R | Recombinant Rat Interleukin 25 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL25-2910MCL | Recombinant Mouse IL25 cell lysate | +Inquiry |
IL25-1261RCL | Recombinant Rat IL25 cell lysate | +Inquiry |
IL25-2920HCL | Recombinant Human IL25 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il25 Products
Required fields are marked with *
My Review for All Il25 Products
Required fields are marked with *
0
Inquiry Basket