Recombinant Active Human IL25 Protein, His-tagged(C-ter)
Cat.No. : | IL25-182H |
Product Overview : | Recombinant Active Human IL25 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cytokine receptor IL17BR. Studies of a similar gene in mice suggest that this cytokine may be a pro-inflammatory cytokine favoring the Th2-type immune response. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is < 5 ng/mL. Determined by its ability to induce CXCL1 secretion in HT29 cells. The ED50 for this effect is < 1 ng/mL. |
AA Sequence : | MYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 8.0) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | IL25 interleukin 25 [ Homo sapiens ] |
Official Symbol | IL25 |
Synonyms | IL25; interleukin 25; IL17E, interleukin 17E; interleukin-25; IL 17E; IL 25; interleukin 17E; interleukin-17E; IL17E; |
Gene ID | 64806 |
mRNA Refseq | NM_022789 |
Protein Refseq | NP_073626 |
MIM | 605658 |
UniProt ID | Q9H293 |
◆ Recombinant Proteins | ||
IL25-149M | Recombinant Mouse IL25, His tagged | +Inquiry |
Il25-1011M | Recombinant Mouse Il25 Protein, MYC/DDK-tagged | +Inquiry |
IL25-151H | Recombinant Human IL25 Protein, His-tagged | +Inquiry |
Il25-805M | Active Recombinant Mouse Il25 | +Inquiry |
Il25-748M | Recombinant Mouse Interleukin 25, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL25-1261RCL | Recombinant Rat IL25 cell lysate | +Inquiry |
IL25-2910MCL | Recombinant Mouse IL25 cell lysate | +Inquiry |
IL25-2920HCL | Recombinant Human IL25 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL25 Products
Required fields are marked with *
My Review for All IL25 Products
Required fields are marked with *
0
Inquiry Basket