Active Recombinant Mouse Il27 Protein, His-Tagged
| Cat.No. : | Il27-01M |
| Product Overview : | Recombinant mouse Il27 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Description : | IL-27 protein is a member of the IL-6 superfamily, which is expressed on monocytes, endothelial cells and dendritic cells. It is also referred to as the IL-12 p35-related protein. IL-27 protein is an early product of activated antigen-presenting cells and drives rapid clonal expansion of naive CD4(+) T cells and plays a role in the early regulation of Th1 cells initiation which drives efficient adaptive immune response. It has an antiproliferative activity on melanomas through WSX-1/STAT1 signaling. Thus, IL-27 protein may be an attractive candidate as an antitumor agent applicable to cancer immunotherapy. |
| Form : | Lyophilized powder |
| AA Sequence : | MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPG GASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQ DLTDYGKPSDWSLPGQVESAPHKP with polyhistidine tag at the C-terminus |
| Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
| Bio-activity : | Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <5 ng/mL |
| Purity : | >95% as determined by SDS-PAGE. Ni-NTA chromatography |
| Storage Buffer : | The protein was lyophilized from a solution containing 20 mM sodium carbonate, 0.2M NaCl, pH 4.5. |
| Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Notes : | Please use within one month after protein reconstitution. |
| Gene Name | Il27 interleukin 27 [ Mus musculus (house mouse) ] |
| Official Symbol | Il27 |
| Synonyms | p28; Il30; IL-27; IL27-A; IL-27-A; IL-27p28 |
| Gene ID | 246779 |
| mRNA Refseq | NM_145636.2 |
| Protein Refseq | NP_663611.1 |
| UniProt ID | Q8K3I6 |
| ◆ Recombinant Proteins | ||
| Il27-554M | Recombinant Mouse Il27 Protein, His-tagged | +Inquiry |
| Il27-506M | Active Recombinant Mouse Interleukin 27 | +Inquiry |
| Il27-185M | Recombinant Active Mouse IL27 Protein, His-tagged(C-ter) | +Inquiry |
| Ebi3&Il27-406M | Active Recombinant Mouse Ebi3&Il27, HIgG1 Fc-tagged | +Inquiry |
| IL27-150H | Recombinant Human IL27, Fc tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL27-001HCL | Recombinant Human IL27 cell lysate | +Inquiry |
| IL27-1309MCL | Recombinant Mouse IL27 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il27 Products
Required fields are marked with *
My Review for All Il27 Products
Required fields are marked with *
