Active Recombinant Mouse Il27 Protein, His-Tagged
Cat.No. : | Il27-01M |
Product Overview : | Recombinant mouse Il27 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | IL-27 protein is a member of the IL-6 superfamily, which is expressed on monocytes, endothelial cells and dendritic cells. It is also referred to as the IL-12 p35-related protein. IL-27 protein is an early product of activated antigen-presenting cells and drives rapid clonal expansion of naive CD4(+) T cells and plays a role in the early regulation of Th1 cells initiation which drives efficient adaptive immune response. It has an antiproliferative activity on melanomas through WSX-1/STAT1 signaling. Thus, IL-27 protein may be an attractive candidate as an antitumor agent applicable to cancer immunotherapy. |
Form : | Lyophilized powder |
AA Sequence : | MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPG GASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQ DLTDYGKPSDWSLPGQVESAPHKP with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <5 ng/mL |
Purity : | >95% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 20 mM sodium carbonate, 0.2M NaCl, pH 4.5. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il27 interleukin 27 [ Mus musculus (house mouse) ] |
Official Symbol | Il27 |
Synonyms | p28; Il30; IL-27; IL27-A; IL-27-A; IL-27p28 |
Gene ID | 246779 |
mRNA Refseq | NM_145636.2 |
Protein Refseq | NP_663611.1 |
UniProt ID | Q8K3I6 |
◆ Recombinant Proteins | ||
IL27-0234M | Active Recombinant Mouse IL27 protein, His-Avi-tagged, Biotinylated | +Inquiry |
IL27-122H | Recombinant Human IL27, MIgG2a Fc-tagged | +Inquiry |
Il27-5204M | Active Recombinant Mouse Il27 Protein | +Inquiry |
IL27-167M | Recombinant Mouse p28 Subunit (IL-27) Protein | +Inquiry |
IL27-124H | Active Recombinant Human IL27, HIgG1 Fc-tagged, mutant | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL27-1309MCL | Recombinant Mouse IL27 cell lysate | +Inquiry |
IL27-001HCL | Recombinant Human IL27 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il27 Products
Required fields are marked with *
My Review for All Il27 Products
Required fields are marked with *