Active Recombinant Rat Csf1

Cat.No. : Csf1-12R
Product Overview : Recombinant Rat Csf1 was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Description : The colony stimulating factor 1 (CSF1), also known as macrophage colony-stimulating factor (M-CSF), is a secreted cytokine which influences hematopoietic stem cells to differentiate into macrophages or other related cell types. Eukaryotic cells also produce M-CSF in order to combat intercellular viral infection. (See colony-stimulating factor.) M-CSF binds to the Colony stimulating factor 1 receptor. It may also be involved in development of the placenta.
Bio-activity : ED50 was determined by the dose-dependent stimulation of the proliferation of murine M-NFS-60 cells is less than or equal to 5.0 ng/ml, corresponding to a specific activity of >2 x 10^5 units/mg.
Molecular Mass : 18.1 kDa
AA Sequence : MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNAN ATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRD VVTKP
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer
Gene Name Csf1 colony stimulating factor 1 (macrophage) [ Rattus norvegicus (Norway rat) ]
Official Symbol Csf1
Synonyms Csf1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; CSF-1; MCSF; NP_076471.3; EC 2.7.10.1
Gene ID 78965
mRNA Refseq NM_023981
Protein Refseq NP_076471
UniProt ID Q8JZQ0
Chromosome Location 2q34
Pathway Cytokine-cytokine receptor interaction; Cytokines and Inflammatory Response (BioCarta); Hematopoietic cell lineage
Function cytokine activity; growth factor activity; macrophage colony-stimulating factor receptor binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Csf1 Products

Required fields are marked with *

My Review for All Csf1 Products

Required fields are marked with *

0
cart-icon