Recombinant Human TNFRSF17 Protein

• Cat.No.: TNFRSF17-5253H
• Product Overview: Recombinant Human TNFRSF17 Protein (5-54 domain) without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 5-54 a.a.
• Description: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation.
• Molecular Mass: Recombinant BCMA is a monomer protein consisting of 50 amino acid residue subunits, and migrates as an approximately 5 kDa protein under non-reducing and reducing conditions in SDS-PAGE.
• AA Sequence: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCL
• Endotoxin: Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 1 ng/μg (1 EU/μg).
• Purity: >95%, as determined by SDS-PAGE and HPLC
• Storage: The lyophilized protein is stable for at least years from date of receipt at -20 centigrade. Upon reconstitution, this product can be stored in working aliquots at -20 centigrade for six months, with a carrier protein without detectable loss of activity. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Recombinant BCMA was lyophilized from a.2 μm filtered% acetonitrile, 1% TFA solutionpH.5.
• Reconstitution: A quick spin of the vial followed by reconstitution in distilled water to a concentration not less than 1 mg/mL. This solution can then be diluted into other buffers.

Gene Information

• Gene Name: TNFRSF17 TNF receptor superfamily member 17 [ Homo sapiens (human) ]
• Official Symbol: TNFRSF17
• Synonyms: TNFRSF17; TNF receptor superfamily member 17; BCM; BCMA; CD269; TNFRSF13A; tumor necrosis factor receptor superfamily member 17; B cell maturation antigen; B-cell maturation factor; B-cell maturation protein
• Gene ID: 608
• mRNA Refseq: NM_001192
• Protein Refseq: NP_001183
• MIM: 109545
• UniProt ID: Q02223